Recombinant Human Olfactory receptor 13C2 (OR13C2)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Classification

OR13C2 (UniProt ID: Q8NGS9) is encoded by the OR13C2 gene located on human chromosome 9. It is classified under the olfactory receptor family 13, subfamily C, member 2. Key features include:

PropertyDetail
Protein Length318 amino acids (full-length)
Structural ClassClass A GPCR with seven transmembrane domains
Conserved MotifsTripodal metal ion-binding site (zinc/copper), class A GPCR motifs
Subcellular LocalizationCell membrane (olfactory neurons, spermatozoa)

Functional Insights and Ligand Interactions

While OR13C2 remains understudied compared to other ORs, emerging data reveal:

Table 2: Key Applications of Recombinant OR13C2

ApplicationMethodologyFindingsReference
Odorant ScreeningHEK293 cell calcium imaging Enables real-time Ca²⁺ influx measurement
Structural StudiesHomology modelingPredicts ligand-binding pockets in transmembrane domains
Reproductive BiologyImmunocytochemistryLocalized to sperm midpiece/flagellum

Challenges and Future Directions

  • Deorphanization: OR13C2’s specific odorants remain unidentified due to low functional expression in heterologous systems .

  • Structural Resolution: No experimental 3D structure exists; cryo-EM studies are needed .

  • Clinical Relevance: Potential links to neurodegenerative diseases via metalloprotein dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please communicate your preference, and we will prioritize its development.
Synonyms
OR13C2; Olfactory receptor 13C2; Olfactory receptor OR9-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13C2
Target Protein Sequence
MEWENHTILVEFFLKGLSGHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLGLAMGTTECVLLGMMAF DRYVAICNPLRYPIIMSKDAYVPMAAGSWIIGAVNSAVQSVFVVQLPFCRNNIINHFTCE ILAVMKLACADISDNEFIMLVATTLFILTPLLLIIVSYTLIIVSIFKISSSEGRSKASST CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN KDVKEAVKHLLNRRFFSK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14701

KEGG: hsa:392376

STRING: 9606.ENSP00000438815

UniGene: Hs.553789

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity and classification of human OR13C2?

Human OR13C2 (UniProt ID: Q8NGS9) is a member of the G-protein-coupled receptor (GPCR) family that functions as an olfactory receptor. Also known as Olfactory receptor OR9-12, it belongs to family 13, subfamily C, member 2 of olfactory receptors . The receptor is encoded by a single coding-exon gene and shares the characteristic 7-transmembrane domain structure common to olfactory receptors and many neurotransmitter and hormone receptors . This receptor is responsible for the recognition and G protein-mediated transduction of odorant signals in olfactory sensory neurons, contributing to the initiation of neuronal responses that trigger the perception of smell .

How does OR13C2 function within the olfactory system's combinatorial coding mechanism?

OR13C2 operates as part of the olfactory system's combinatorial code, wherein a single odorant molecule can activate multiple receptors, and each receptor can respond to several different molecules . This coding mechanism enables a relatively small number of receptors (typically a few hundred) to discriminate among tens of thousands of distinct odors . Within this system, OR13C2 contributes to odor perception by recognizing specific structural features of odorant molecules and transducing this recognition into cellular signals. Even minor alterations in the functionality of a single receptor like OR13C2 can lead to notable perceptual consequences, highlighting the importance of each receptor within the broader olfactory coding scheme .

What experimental systems are commonly used to study recombinant OR13C2?

Researchers typically employ heterologous expression systems to study recombinant OR13C2, similar to other olfactory receptors. These systems include human embryonic kidney cells (HEK293), especially those modified with accessory factors like the Hana3A cell line that expresses chaperon proteins (RTP1, RTP2), olfactory G-proteins, and rho tag to enhance receptor trafficking to the cell surface . Other systems include human prostate carcinoma cell lines (LNCaP), which have demonstrated different response profiles for certain ORs compared to HEK293 cells . For functional studies, both native olfactory sensory neurons (OSNs) and these heterologous expression systems are utilized, with luciferase assays being among the most common response measurement techniques (representing 41% of bioassay results in the M2OR database) .

What are the optimal conditions for heterologous expression of recombinant OR13C2?

For optimal heterologous expression of recombinant OR13C2, researchers should consider the following methodological approach:

  • Cell Line Selection: Hana3A cells (a variant of HEK293 cells) are recommended as they express accessory proteins that enhance OR trafficking to the cell membrane, including RTP1, RTP2, and olfactory G-proteins .

  • Vector Design: A mammalian expression vector containing:

    • The complete OR13C2 coding sequence (NP_001004481.1)

    • A rho tag to facilitate membrane localization

    • A strong promoter (e.g., CMV)

  • Transfection Protocol: Lipofection methods typically yield higher transfection efficiency than electroporation for ORs.

  • Expression Conditions:

    • Temperature: 37°C

    • CO₂: 5%

    • Incubation time: 24-48 hours post-transfection before conducting functional assays

  • Validation Methods: Expression should be confirmed through Western blotting and immunofluorescence using antibodies against either the OR13C2 protein or an included epitope tag.

It's critical to note that assay-dependent bias has been observed in OR studies, with some ligands identified in LNCaP cells not recognized when the same receptors were expressed in HEK293 cells . Therefore, validation across multiple expression systems may provide more comprehensive characterization of OR13C2 functionality.

How should researchers design luciferase-based assays to evaluate OR13C2-odorant interactions?

A methodologically sound luciferase-based assay for OR13C2-odorant interaction screening should follow this protocol:

  • Co-transfection Components:

    • OR13C2 expression plasmid

    • CRE-luciferase reporter construct (for cAMP-mediated signaling)

    • Renilla luciferase plasmid (for normalization)

    • Accessory protein plasmids (RTP1S, REEP1, and Gα15)

  • Assay Setup:

    • Plate format: 96-well or 384-well

    • Cell density: 1-2 × 10⁴ cells per well

    • Transfection timing: 18-24 hours before odorant exposure

  • Odorant Preparation:

    • Concentration range: Initial screening at 100 μM, followed by dose-response curves (10⁻⁸ to 10⁻³ M)

    • Vehicle control: Usually DMSO (final concentration <0.1%)

    • Dilution medium: CD293 serum-free medium

  • Signal Detection:

    • Incubation time: 4 hours post-odorant application

    • Luminescence measurement: Dual-luciferase reporter assay system

    • Normalization: Firefly luciferase activity relative to Renilla luciferase

  • Data Analysis:

    • Response calculation: Fold change relative to vehicle control

    • Positive response threshold: ≥3-fold increase AND statistically significant difference (p<0.05)

    • EC₅₀ determination: Non-linear regression curve fitting

This assay design reflects the most common approach used in OR-odorant interaction studies, accounting for 41% of bioassay results in the M2OR database .

What methodological considerations are important when designing structure-function studies for OR13C2?

When designing structure-function studies for OR13C2, researchers should implement the following methodological framework:

  • Mutation Strategy Planning:

    • Target conserved residues in transmembrane domains based on sequence alignment with functionally characterized ORs

    • Focus on putative binding pocket residues (typically TM3, TM5, and TM6)

    • Employ both alanine scanning and targeted substitutions based on physicochemical properties

  • Mutagenesis Protocol:

    • Site-directed mutagenesis using overlap extension PCR or commercial kits

    • Confirmation of mutations through full-length sequencing

    • Preparation of multiple mutant constructs with identical tags/fusion partners as the wild-type

  • Functional Comparative Analysis:

    • Parallel testing of wild-type and mutant receptors in identical conditions

    • Evaluation of multiple parameters:

      • Surface expression (through immunocytochemistry)

      • Basal activity levels

      • EC₅₀ shifts for known ligands

      • Changes in ligand selectivity profiles

  • Data Interpretation Framework:

    • Distinguish between mutations affecting:

      • Protein folding/trafficking (global response reduction)

      • Ligand binding (ligand-specific effects)

      • G-protein coupling (altered signaling dynamics)

  • Molecular Modeling Integration:

    • Generate homology models based on available GPCR crystal structures

    • Validate model predictions with experimental mutation results

    • Refine models iteratively based on functional data

This approach enables researchers to distinguish between mutations that affect general receptor functionality versus those specifically involved in odorant recognition, providing insights into the molecular mechanism of OR13C2 activation.

How should researchers address the challenge of concentration-dependent responses in OR13C2 studies?

To methodically address concentration-dependent responses in OR13C2 studies, researchers should implement this comprehensive analytical approach:

  • Experimental Design for Concentration Analysis:

    • Employ a wide concentration range (typically 10⁻⁹ to 10⁻³ M) with smaller increments (half-log steps) around anticipated threshold values

    • Include both positive controls (known OR13C2 agonists) and negative controls (vehicle and odorants known not to activate OR13C2)

    • Test each concentration in at least triplicate across independent experimental runs

  • Data Processing Protocol:

    • Calculate normalized response amplitudes relative to maximum response of a reference agonist

    • Generate concentration-response curves using four-parameter logistic regression

    • Determine key pharmacological parameters:

      • EC₅₀ (half-maximal effective concentration)

      • Hill coefficient (slope)

      • Emax (maximal efficacy)

  • Threshold Determination Methodology:

    • Statistical significance: Define activation threshold as concentration producing response significantly above baseline (p<0.05)

    • Signal-to-noise ratio: Alternatively, use a defined threshold (e.g., ≥3-fold increase over baseline)

    • Document both the screening concentration and EC₅₀ for all experiments

  • Analysis of Concentration-Dependent Phenomena:

    • Identify potential cases of bimodal responses or bell-shaped curves

    • Evaluate potential mechanisms (receptor desensitization, cytotoxicity, altered signaling pathways)

    • Compare with literature data on similar odorant-receptor pairs

This approach aligns with the M2OR database practices, which uniquely includes both screening concentration and EC₅₀ values for all experimental data, allowing analysis beyond simple responsiveness to account for the reality that odorant perception changes with concentration .

What statistical approaches are most appropriate for analyzing OR13C2 ligand screening data?

For rigorous analysis of OR13C2 ligand screening data, the following statistical methodology should be implemented:

  • Primary Screening Analysis:

    • Normalization Method: Z-score transformation based on negative controls

    • Hit Identification:

      • Statistical threshold: Z-score ≥ 3 or p-value < 0.01

      • Biological threshold: ≥3-fold activation over baseline

      • Application of false discovery rate (FDR) correction for multiple testing

  • Confirmatory Dose-Response Analysis:

    • Curve Fitting: Four-parameter logistic regression with constraint parameters

    • Parameter Extraction:

      • EC₅₀ with 95% confidence intervals

      • Hill slope coefficient

      • Maximum efficacy (relative to reference compound)

    • Goodness-of-fit Assessment: R² values and residual analysis

  • Comparative Potency Analysis:

    • Rank-ordering Method: Based on EC₅₀ values with statistical comparison using one-way ANOVA with post-hoc tests

    • Efficacy Classification: Full agonists (>80% of reference response), partial agonists (20-80%), weak agonists (<20%)

  • Structure-Activity Relationship (SAR) Analysis:

    • Similarity Clustering: Hierarchical clustering of compounds based on chemical fingerprints

    • Correlation Analysis: Pearson or Spearman correlation between structural features and activation parameters

    • Machine Learning Models: Random forest or support vector machine classification of active vs. inactive compounds

  • Reliability Assessment:

    • Assay Quality Metrics: Z' factor calculation for each plate (acceptable >0.5)

    • Reproducibility Analysis: Intraclass correlation coefficient between replicates

    • Outlier Detection: Grubbs' test or modified Z-score method

This comprehensive statistical approach ensures robust identification of true OR13C2 ligands while minimizing false positives and extracting meaningful pharmacological parameters from screening data.

How can researchers integrate OR13C2 experimental data with computational models of odorant binding?

To effectively integrate OR13C2 experimental data with computational models, researchers should follow this methodological framework:

  • Experimental Data Preparation:

    • Standardize activity data across different assay types using normalized response values

    • Classify compounds by activity level (strong agonist, weak agonist, non-active)

    • Generate a comprehensive dataset of chemical descriptors for all tested compounds

    • Ensure stereochemical accuracy for all molecules, as enantiomers can trigger different OR responses

  • Homology Modeling Protocol:

    • Select appropriate GPCR template structures (preferably class A GPCRs)

    • Generate multiple alignments prioritizing conserved GPCR motifs

    • Construct models with special attention to the putative binding pocket

    • Perform energy minimization and molecular dynamics simulation to refine models

    • Validate models using Ramachandran plots and QMEAN scores

  • Binding Site Identification:

    • Employ site-finder algorithms based on geometric and energetic properties

    • Cross-validate predicted sites with experimental mutagenesis data

    • Identify key residues through conservation analysis and structural considerations

  • Molecular Docking Methodology:

    • Prepare ligand libraries with proper protonation states at physiological pH

    • Perform flexible docking with multiple scoring functions

    • Analyze docking poses clustering and binding energy distributions

    • Validate results against experimental structure-activity relationships

  • Model Refinement Workflow:

    • Iteratively update models based on new experimental data

    • Employ machine learning techniques to improve prediction accuracy

    • Use bioassay metadata (cell lines, assay types) to estimate response confidence levels

    • Calculate correlation between predicted binding affinity and experimental EC₅₀ values

This integrative approach leverages both experimental data and computational techniques to develop increasingly accurate models of OR13C2-odorant interactions, which can subsequently guide more focused experimental designs.

What are the current challenges in deorphanizing OR13C2 and related olfactory receptors?

The deorphanization of OR13C2 faces several methodological challenges that researchers must address through systematic experimental approaches:

  • Promiscuity and Specificity Balance:

    • The combinatorial nature of olfactory coding means OR13C2 likely responds to multiple structurally diverse odorants with varying affinities

    • Researchers must distinguish physiologically relevant ligands from experimental artifacts by:

      • Testing across multiple concentration ranges

      • Comparing EC₅₀ values to estimated nasal cavity concentrations

      • Evaluating response patterns across related receptor subtypes

  • Expression System Limitations:

    • Significant assay-dependent bias exists in OR response profiles, with some ligands identified in one cell line (e.g., LNCaP) not recognized in others (e.g., HEK293)

    • Methodological solution: Implement parallel screening in multiple heterologous systems:

      • Hana3A cells with accessory proteins

      • Native olfactory sensory neurons

      • Other expression systems with different signaling machinery

  • Concentration-Dependent Activation Profiles:

    • Odorant concentration dramatically influences receptor activation patterns, requiring:

      • Comprehensive dose-response analysis rather than single-point screening

      • Documentation of both screening concentration and EC₅₀

      • Consideration of physiological relevance of test concentrations

  • Stereochemical Complexity:

    • Certain ORs show differential responses to enantiomers (e.g., OR1A1)

    • Methodological requirements:

      • Complete stereochemical characterization of test compounds

      • Testing of individual stereoisomers rather than racemic mixtures

      • Correlation of stereochemical features with activation profiles

This multi-faceted approach is necessary given that even with the comprehensive M2OR database containing 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs, only 6% show activation (3,100 active pairs vs. 48,295 non-responsive pairs) , highlighting the challenge of deorphanization.

How might OR13C2 research contribute to understanding broader questions in olfactory neuroscience?

OR13C2 research can address fundamental questions in olfactory neuroscience through these methodological approaches:

  • Combinatorial Coding Mechanisms:

    • Experimental Approach: Construct a comprehensive OR13C2 activation profile across diverse odorant classes and compare with other characterized ORs

    • Analytical Framework: Apply mathematical models of combinatorial coding to predict perceptual outcomes from receptor activation patterns

    • Contribution: Help elucidate how a relatively small number of receptors (a few hundred) enable discrimination of tens of thousands of odors

  • Genetic Variation Impact on Perception:

    • Methodological Strategy:

      • Screen naturally occurring OR13C2 variants for functional differences using identical odorant panels

      • Correlate variant response profiles with psychophysical test results from human subjects

    • Significance: Help explain how "minor alterations in the functionality of a single receptor can lead to notable perceptual consequences"

  • Olfactory Neural Circuit Organization:

    • Research Design: Trace the projection patterns of OR13C2-expressing neurons in the olfactory bulb using genetic labeling techniques

    • Analytical Approach: Map the connectivity patterns and compare with other ORs activated by similar or different odorants

    • Knowledge Advancement: Contribute to understanding how receptor-specific inputs are integrated into higher-order olfactory processing

  • Evolution of Olfactory Receptor Function:

    • Comparative Methodology:

      • Clone OR13C2 orthologs from multiple species

      • Express in identical systems and evaluate responses to the same odorant panel

      • Correlate functional differences with habitat and ecological niche

    • Significance: Provide insights into how selective pressures shape olfactory receptor repertoires and functions

Through these research directions, OR13C2 studies can contribute to addressing broader scientific questions about olfactory system organization, evolution, and sensory perception mechanisms.

What methodological approaches should researchers use to correlate OR13C2 activation with perceptual outcomes?

To establish meaningful correlations between OR13C2 activation and olfactory perception, researchers should implement this multi-level methodological framework:

  • In Vitro Characterization Protocol:

    • Generate comprehensive activation profiles for OR13C2 across structurally diverse odorants

    • Determine precise pharmacological parameters:

      • Full dose-response curves (10⁻⁹ to 10⁻³ M)

      • EC₅₀ and Hill coefficient values for all active compounds

      • Temporal response characteristics (activation/deactivation kinetics)

    • Document assay-specific variables that might influence results

  • Psychophysical Testing Design:

    • Participant Selection: Screen for genetic variants in OR13C2 coding regions

    • Stimulus Preparation:

      • Present odorants at concentrations spanning OR13C2 activation thresholds

      • Include compounds with similar structures but different OR13C2 activation profiles

    • Measurement Parameters:

      • Detection thresholds

      • Discrimination accuracy

      • Intensity and quality ratings

      • Temporal adaptation profiles

  • Correlation Analysis Framework:

    • Direct Parameter Correlation:

      • Test for statistical relationships between EC₅₀ values and detection thresholds

      • Compare receptor activation efficacy with perceived intensity ratings

    • Mixture Interaction Analysis:

      • Test mixtures of OR13C2 agonists and antagonists

      • Correlate mixture perceptual outcomes with predicted receptor activation patterns

  • Causal Relationship Validation:

    • Genetic Association Studies:

      • Compare perceptual responses between individuals with functional vs. non-functional OR13C2 variants

      • Analyze how specific mutations affecting OR13C2 function correlate with perceptual differences

    • Animal Model Approaches:

      • Utilize gene editing to modify OR13C2 orthologs in model organisms

      • Assess behavioral responses to OR13C2 agonists before and after genetic modification

This comprehensive approach acknowledges that olfactory perception depends on concentration and that changes in concentration can lead to different perceptions of hedonicity or olfactory quality , while also addressing the combinatorial nature of the olfactory code.

How can researchers leverage the M2OR database for OR13C2 studies?

Researchers can maximize the utility of the M2OR database (https://m2or.chemsensim.fr/) for OR13C2 studies through this methodological approach:

  • Search Strategy Optimization:

    • Direct Receptor Query: Search specifically for OR13C2 experiments using "Gene name" field

    • Ligand-Based Discovery: Identify molecules tested with OR13C2 using chemical identifiers (CID, CAS, InChIKey, SMILES)

    • Comparative Analysis: Search for receptors with similar response profiles by identifying shared ligands

    • Batch Search Capability: Utilize bulk search functionality with standard molecule and receptor identifiers for high-throughput analysis

  • Data Extraction and Filtering Protocol:

    • Experimental Parameters Filtration:

      • Filter by assay type (e.g., luciferase assays vs. calcium imaging)

      • Narrow results by cell line (e.g., Hana3A, HEK293, LNCaP)

      • Select specific concentration ranges relevant to research question

    • Response Type Classification:

      • Extract both active (agonist) and non-responsive pairs for complete analysis

      • Document screening concentration and/or EC₅₀ values for all data points

  • Experimental Design Guidance:

    • Control Selection: Identify validated positive and negative controls for OR13C2 assays

    • Concentration Determination: Use reported effective concentrations to inform experimental design

    • Assay Selection: Compare results across different assay types to identify optimal experimental approaches

    • Stereochemistry Considerations: Ensure proper stereochemical specifications based on curated information

  • Comparative Analysis Framework:

    • OR Family Patterns: Compare OR13C2 response profile with related olfactory receptors

    • Shared Ligand Analysis: Identify compounds that activate multiple receptors including OR13C2

    • Specificity Assessment: Evaluate ligand selectivity across the OR family

The comprehensive nature of M2OR, which contains 75,050 bioassay experiments including both active and non-responsive pairs with detailed experimental metadata , makes it an invaluable resource for informed OR13C2 experimental design and data interpretation.

What genetic and molecular tools are available for studying OR13C2 expression and function?

Researchers investigating OR13C2 can employ the following molecular and genetic tools:

  • Expression Analysis Tools:

    • RNA-based Methods:

      • RT-qPCR primers specific to OR13C2 mRNA (NM_001004481.1)

      • RNAscope in situ hybridization probes for tissue localization

      • RNA-seq analysis workflows for olfactory epithelium transcriptomics

    • Protein Detection Methods:

      • Commercial antibodies against OR13C2 (validation required)

      • Epitope-tagging strategies (N-terminal signal sequence preservation critical)

      • Fluorescent protein fusion constructs (e.g., OR13C2-GFP)

  • Functional Manipulation Tools:

    • Gene Silencing Reagents:

      • MISSION® esiRNA targeting human OR13C2 (EHU117721)

      • Custom shRNA constructs with validated knockdown efficiency

      • CRISPR-Cas9 guide RNA designs targeting OR13C2 locus

    • Expression Enhancement:

      • Codon-optimized OR13C2 constructs for mammalian expression

      • Trafficking enhancement with RTP1S and REEP1 co-expression

      • Rhodopsin tag (first 20 amino acids) fusion for improved membrane localization

  • Reporter Systems:

    • Signaling Pathway Indicators:

      • CRE-luciferase reporters for cAMP-mediated signaling

      • GCaMP calcium indicators for real-time activation monitoring

      • BRET-based G-protein coupling assays

    • Trafficking Assessment Tools:

      • Surface expression assays using extracellular epitope tags

      • ER retention reporters to measure folding efficiency

  • Animal Models:

    • Genetically Modified Mice:

      • OR13C2 ortholog knockout models

      • Humanized OR13C2 replacement models

      • OR13C2-IRES-tauGFP for neuronal circuit tracing

  • Bioinformatic Resources:

    • Sequence Analysis Tools:

      • OR13C2 genetic variant databases (RefSeq: NP_001004481.1)

      • Multiple sequence alignment with related ORs for conserved motif identification

      • Homology modeling templates based on GPCR crystal structures

    • Expression Databases:

      • Single-cell RNA-seq datasets of olfactory epithelium

      • Tissue expression profiles across development and aging

These tools provide researchers with a comprehensive toolkit for investigating OR13C2 at multiple biological levels, from genetic regulation to functional characterization.

What are the key considerations for experimental reproducibility in OR13C2 research?

To ensure experimental reproducibility in OR13C2 research, investigators should implement these methodological safeguards:

  • Receptor Expression Standardization:

    • Construct Validation Protocol:

      • Full sequence verification of expression plasmids

      • Quantification of expression levels across experimental batches

      • Consistent use of epitope tags or fusion proteins

    • Quality Control Metrics:

      • Surface expression quantification before functional assays

      • Western blot confirmation of protein size and integrity

      • Consistent passage numbers for stable cell lines

  • Assay Condition Standardization:

    • Cell Culture Parameters:

      • Standardized protocols for cell maintenance and transfection

      • Consistent cell density and time points for experiments

      • Regular mycoplasma testing and cell line authentication

    • Reagent Quality Control:

      • Odorant purity verification (>95% by analytical methods)

      • Fresh preparation of stock solutions with documented storage conditions

      • Complete stereochemical characterization of test compounds

  • Data Collection Standardization:

    • Concentration Consistency:

      • Document both screening concentration and EC₅₀ values

      • Use consistent concentration ranges across experiments

      • Apply identical vehicle controls (typically DMSO <0.1%)

    • Response Normalization:

      • Consistent positive and negative controls across experiments

      • Standardized normalization methods for response amplitude

      • Regular calibration of detection instruments

  • Experimental Design Requirements:

    • Controls Implementation:

      • Empty vector controls for background responses

      • Known OR agonist controls for assay functionality

      • Multiple reference ORs for comparative analyses

    • Statistical Considerations:

      • A priori power analysis to determine sample size

      • Minimum of three independent biological replicates

      • Appropriate statistical tests with multiple comparison corrections

  • Comprehensive Reporting Protocol:

    • Experimental Details Documentation:

      • Cell line information including any stable modifications

      • Complete experimental procedures including timing

      • All assay metadata consistent with M2OR database fields

    • Data Sharing Practices:

      • Raw data availability in standard formats

      • Detailed protocols with troubleshooting notes

      • Deposit of results in standardized databases like M2OR

This comprehensive approach to experimental reproducibility addresses the challenges identified in OR research, including assay-dependent bias and the need for detailed metadata to properly interpret results.

How can OR13C2 research contribute to understanding olfactory disorders?

OR13C2 research can advance our understanding of olfactory disorders through these methodological approaches:

  • Genetic Variation Analysis Protocol:

    • Clinical Cohort Studies:

      • Sequence OR13C2 in patients with specific olfactory deficits

      • Compare variant frequencies between normosmic and hyposmic/anosmic populations

      • Correlate specific variants with quantitative olfactory function tests

    • Functional Characterization Workflow:

      • Express identified variants in heterologous systems

      • Compare activation profiles with wild-type OR13C2

      • Assess trafficking efficiency and membrane localization

  • Molecular Pathology Investigation:

    • Receptor Expression Analysis:

      • Quantify OR13C2 expression in olfactory epithelium biopsies from patients

      • Compare expression levels across different olfactory disorders

      • Correlate with olfactory function test results

    • Single-Cell Profiling Approach:

      • Analyze OR13C2-expressing neurons using single-cell transcriptomics

      • Compare cellular phenotypes between healthy and diseased tissues

      • Identify associated signaling pathway alterations

  • Olfactory Circuit Assessment:

    • Functional Imaging Protocol:

      • Identify OR13C2-specific odorants through comprehensive screening

      • Use these odorants in fMRI studies with genotyped subjects

      • Compare activation patterns between subjects with functional vs. non-functional OR13C2 variants

    • Circuit Tracing Methodology:

      • Map neural projections from OR13C2-expressing neurons in animal models

      • Assess circuit alterations in disease models

  • Therapeutic Target Exploration:

    • Receptor Modulation Strategy:

      • Screen for compounds that can rescue trafficking-deficient OR13C2 variants

      • Identify allosteric modulators that can enhance receptor sensitivity

      • Develop targeted gene therapy approaches for OR13C2 locus

This research direction leverages the understanding that "even minor alterations in the functionality of a single receptor can lead to notable perceptual consequences" , providing a molecular foundation for investigating specific olfactory dysfunctions.

What is the potential for using OR13C2 in biosensor applications?

OR13C2 offers several methodological approaches for biosensor development:

  • Cell-Based Biosensor Platform Design:

    • Engineering Protocol:

      • Stable cell lines expressing optimized OR13C2 constructs

      • Integration with real-time reporter systems (calcium indicators, BRET sensors)

      • Microfluidic systems for continuous sampling and response monitoring

    • Performance Metrics:

      • Detection limits based on EC₅₀ values from dose-response curves

      • Response kinetics (activation/deactivation times)

      • Selectivity profile against structural analogs

      • Long-term stability and reproducibility assessment

  • Cell-Free Biosensor Development:

    • Receptor Preparation Methodology:

      • Detergent-solubilized OR13C2 purification protocol

      • Reconstitution in nanodiscs or liposomes

      • Oriented immobilization on sensor surfaces

    • Detection System Options:

      • Surface plasmon resonance (SPR) for direct binding detection

      • Quartz crystal microbalance (QCM) for mass-based sensing

      • Field-effect transistor (FET) for charge-based detection

  • Synthetic Biology Approaches:

    • Receptor Engineering Strategy:

      • Structure-guided mutagenesis to enhance stability or specificity

      • Chimeric receptors combining OR13C2 with stable GPCR scaffolds

      • Computational design of OR13C2 variants with desired properties

    • Signal Amplification Methods:

      • Engineered G-protein coupling for enhanced signal output

      • Synthetic signaling cascades with enzymatic amplification

      • Split-reporter complementation for enhanced sensitivity

  • Performance Optimization Framework:

    • Sensitivity Enhancement:

      • Co-expression with RTP1, RTP2 and other accessory proteins

      • Optimized expression conditions based on cell line selection

      • Signal processing algorithms for noise reduction

    • Specificity Improvement:

      • Receptor arrays combining OR13C2 with other ORs for pattern recognition

      • Machine learning integration for signal classification

      • Cross-reactive sensor networks based on combinatorial coding principles

This methodological approach takes advantage of the natural sensitivity and selectivity of OR13C2 while addressing the challenges in working with these complex membrane proteins in non-native environments.

How might OR13C2 research contribute to drug discovery for neurological disorders?

OR13C2 research can inform drug discovery for neurological disorders through these methodological approaches:

  • GPCR Structural Biology Applications:

    • Comparative Analysis Protocol:

      • Align OR13C2 with neurologically relevant GPCRs to identify conserved motifs

      • Map binding pocket architecture similarities with neurotransmitter receptors

      • Use insights from OR13C2-ligand interactions to inform drug design for related GPCRs

    • Methodology Transfer:

      • Apply successful expression and purification strategies from OR13C2 to challenging neurological GPCRs

      • Translate combinatorial screening approaches to neurotransmitter receptor drug discovery

      • Adapt trafficking enhancement techniques to improve expression of CNS drug targets

  • Olfactory-Neurological Connection Investigation:

    • Clinical Correlation Studies:

      • Evaluate OR13C2 function in patients with neurodegenerative disorders

      • Assess olfactory deficits as early biomarkers for neurological disease

      • Correlate OR13C2 genetic variants with disease risk or progression

    • Mechanistic Research Design:

      • Investigate shared cellular pathways between olfactory neurons and affected CNS regions

      • Examine protein misfolding mechanisms common to OR13C2 and neurological disease proteins

      • Study protective mechanisms in the olfactory system that might be applicable to neuroprotection

  • Drug Delivery System Development:

    • Intranasal Delivery Optimization:

      • Use OR13C2-expressing regions as targets for nose-to-brain drug delivery

      • Develop ligand-directed drug conjugates that utilize olfactory transport pathways

      • Design formulations that enhance drug targeting to OR13C2-rich regions

    • Methodological Approach:

      • In vitro blood-brain barrier models incorporating olfactory transport mechanisms

      • Animal models with fluorescently-tagged compounds to trace distribution

      • Pharmacokinetic studies comparing intranasal vs. systemic administration

  • Functional Screening Platform Development:

    • Assay Adaptation Strategy:

      • Modify successful OR13C2 heterologous expression systems for neurological drug targets

      • Implement high-throughput screening protocols developed for OR13C2 to neurotransmitter receptors

      • Utilize luciferase-based assays optimized for ORs in CNS drug discovery

    • Translational Research Design:

      • Identify compounds that modulate both OR13C2 and neurologically relevant targets

      • Explore dual-acting compounds with olfactory and CNS effects

      • Study off-target effects of CNS drugs on olfactory function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.