Recombinant Human Olfactory receptor 13C5 (OR13C5)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR13C5

OR13C5 (olfactory receptor family 13 subfamily C member 5) is a protein-coding gene located on chromosome 9 in humans. Key features include:

PropertyDetail
Gene ID138799
Protein Uniprot IDQ8NGS8
SynonymsOR9-11
Protein Length318 amino acids (full-length)
Structural Domains7-transmembrane GPCR architecture
Tissue ExpressionPrimarily olfactory epithelium; ectopic expression in pancreas and lung

The receptor’s structure includes extracellular N-terminal FLAG and C-terminal rho1D4 epitope tags for purification and detection in heterologous systems .

Recombinant Production Methods

Recombinant OR13C5 is synthesized using in vitro expression systems to ensure high purity and functionality:

  • Expression System: Stable tetracycline-inducible HEK293S cells .

  • Purification:

    • Anti-FLAG immunoaffinity chromatography .

    • Gel filtration to isolate monomeric (1.6 mg) and dimeric (1.1 mg) forms from 60 T175 flasks .

  • Storage: -20°C or -80°C in lyophilized form; avoid repeated freeze-thaw cycles .

Ligand Binding and Activation

  • Primary Ligand: Dihydrojasmone binds with micromolar affinity (KdK_d ~ µM range) .

  • Detection Method: Intrinsic tryptophan fluorescence assays quantify ligand-receptor interactions .

  • Signal Transduction: Activates cAMP pathways in HEK293S cells, measured via real-time cAMP assays .

Functional Implications

  • Cancer Research: OR13C5 mutations are reported in pancreatic cancer genomes, though functional links remain under investigation .

  • Ectopic Expression: Detected in non-olfactory tissues, suggesting roles beyond odor detection .

Applications and Future Directions

  • Drug Discovery: Structural insights may aid GPCR-targeted drug design .

  • Biomarker Potential: Upregulated in carcinoma tissues, warranting exploration as a diagnostic marker .

  • Deorphanization Challenges: OR13C5 remains understudied compared to other ORs; ligand screens using databases like M2OR could expand its known interactome .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your preference when placing your order, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are typically shipped with standard blue ice packs. For dry ice shipping, please communicate your request in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR13C5; Olfactory receptor 13C5; Olfactory receptor OR9-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13C5
Target Protein Sequence
MEWENHTILVEFFLKGLSGHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF DRYVAICNPLRYPIIMSKDAYVPMAAGSWIIGAVNSAVQTVFVVQLPFCRNNIINHFTCE ILAVMKLACADISGNEFILLVTTTLFLLTPLLLIIVSYTLIILSIFKISSSEGRSKPSST CSARLTVVITFCGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRN KDVKEAVKHLLRRKNFNK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15100

KEGG: hsa:138799

STRING: 9606.ENSP00000363911

UniGene: Hs.553598

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does OR13C5 relate to other olfactory receptors?

OR13C5 shares structural and functional similarities with other olfactory receptors, such as OR13A1, which is also classified within the G-protein coupled receptor 1 family. While OR13A1 is a 328 amino acid protein , OR13C5 has gained particular research interest due to its genetic variants being associated with RSV susceptibility .

What genetic variants of OR13C5 are significant in research?

The most significant genetic variant identified in OR13C5 is the SNP rs199665292, which has been identified as a key candidate variant (P-value = 1.16 × 10^-12; OR = 5.56) associated with susceptibility to severe RSV disease requiring hospitalization. This is an exonic synonymous SNP located in the OR13C5 gene .

Why is OR13C5 of interest in infectious disease research?

OR13C5 has emerged as a gene of interest in infectious disease research because whole exome sequencing has revealed its potential role in host genomic susceptibility to respiratory syncytial virus (RSV). This finding aligns with emerging evidence suggesting olfactory receptors may play previously unrecognized roles in viral infectious diseases .

What methodologies are optimal for studying OR13C5 function in vitro?

For in vitro studies of OR13C5 function, researchers should consider cell-free expression systems similar to those used for recombinant OR13A1 production, which achieve ≥85% purity suitable for SDS-PAGE analysis . Additionally, researchers should employ whole exome sequencing (WES) protocols similar to those used in the RSV susceptibility studies, including Agilent's SureSelectXT Human All Exon V5 exome design, with sequencing performed on platforms like Illumina HiSeq2000 using TruSeq v3 chemistry .

How can researchers effectively analyze OR13C5 genetic variants in population studies?

Effective analysis of OR13C5 genetic variants requires robust bioinformatics pipelines. Reads should be mapped to the reference human genome using tools like Burrows-Wheeler Aligner (BWA), with local realignment around potential insertion/deletion sites using Genome Analysis Tool Kit (GATK). Base quality scores should be recalibrated using GATK's covariance recalibration to enhance variant call quality. Statistical analysis should include Fisher's Exact Test for calculating odds ratios and p-values when comparing patient cohorts with control groups .

What are the challenges in interpreting synonymous SNPs like rs199665292 in OR13C5?

Interpreting synonymous SNPs like rs199665292 in OR13C5 presents several challenges. Despite not changing the amino acid sequence, these variants may affect mRNA stability, splicing, or translation efficiency. In the case of rs199665292, its strong association with RSV susceptibility (OR IBS = 9.09; P-value IBS = 2.53 × 10^-12) suggests functional significance despite being synonymous. Researchers must employ techniques beyond simple sequence analysis, including expression studies and functional assays, to determine how this synonymous variant influences OR13C5 function and contributes to disease susceptibility .

How does OR13C5 compare to other genes implicated in RSV susceptibility?

OR13C5 stands out among genes implicated in RSV susceptibility, with SNP rs199665292 showing the strongest association (P-value ALL = 1.16 × 10^-12; OR ALL = 5.56). Other genes with significant associations include HLA-DQA1 (P-value ALL = 1.43 × 10^-09; OR ALL = 0.06) and MUC4, which contains both synonymous and non-synonymous variants associated with RSV susceptibility. The table below compares the statistical significance of these associations :

SNPGeneExonic functionOR IBSP-value IBSOR ALLP-value ALL
rs199665292OR13C5Synonymous9.092.53 × 10^-125.561.16 × 10^-12
rs1047985HLA-DQA1UTR50.052.21 × 10^-100.061.43 × 10^-09
rs201623571MUC4Non-synonymous0.083.55 × 10^-100.102.48 × 10^-10
rs529417345MUC4Synonymous0.039.40 × 10^-100.035.31 × 10^-10

What sequencing approaches are recommended for OR13C5 studies?

For comprehensive OR13C5 genetic studies, whole exome sequencing is recommended, following protocols similar to those employed in the RSV susceptibility research. Samples should be prepared according to Agilent's SureSelect Protocol, with enrichment conducted per SureSelect protocols. Library concentration should be determined using QPCR NGS Library Quantification Kit, with samples pooled prior to sequencing at a final concentration of 10nM. Sequencing should be performed on high-throughput platforms like Illumina HiSeq2000 using TruSeq v3 chemistry to ensure adequate coverage (the reference study achieved an average on-target coverage of 64.23×) .

How should researchers control for population stratification in OR13C5 association studies?

To control for population stratification in OR13C5 association studies, researchers should employ multiple control groups representing diverse populations. In the RSV susceptibility study, the investigators used the Iberian sample (IBS) from The 1000 Genomes Project as the primary control group, but also validated findings using other European controls (CEU, GRB, TSI) and Spanish controls. This approach allows for pseudo-replication and validation of findings across different population backgrounds. Additionally, researchers should conduct separate analyses with each control group and with merged data sets to ensure consistency of association signals .

What are the best practices for validating OR13C5 variant associations?

Best practices for validating OR13C5 variant associations include: 1) Initial discovery in a well-characterized cohort, 2) Replication in independent populations, 3) Use of multiple statistical approaches including single-variant analysis and gene-based collapsing methods weighted by pathogenicity, 4) Careful quality control of sequencing data with appropriate mapping, alignment, and local realignment around potential indel sites, 5) Functional validation of identified variants through in vitro or in vivo studies to establish biological plausibility. The RSV study demonstrated this approach by validating their findings using multiple control groups and confirming signals through different analytical methods .

How does OR13C5 contribute to respiratory viral susceptibility?

OR13C5 contributes to respiratory viral susceptibility through genetic variations that may alter host-virus interactions. The SNP rs199665292 in OR13C5 shows the strongest association with severe RSV disease requiring hospitalization (P-value = 1.16 × 10^-12; OR = 5.56). Although this is a synonymous SNP, it may affect OR13C5 expression or function through mechanisms like altered mRNA stability or translation efficiency. This finding aligns with emerging evidence suggesting that olfactory receptors may play previously unrecognized roles in viral infectious diseases beyond their canonical function in odor detection .

What is the significance of finding olfactory receptor associations in RSV disease?

The association between OR13C5 variants and RSV susceptibility represents a paradigm shift in understanding olfactory receptor functions. This finding suggests that olfactory receptors may have important immunomodulatory roles or serve as entry points for respiratory viruses. The study identifying OR13C5 as a candidate gene also found associations with taste receptors (TAS2R19), suggesting a broader role for chemosensory receptors in infectious disease susceptibility. These discoveries open new avenues for understanding host-pathogen interactions and potentially developing novel therapeutic approaches targeting these receptors .

How do synonymous variants in OR13C5 potentially affect function?

Synonymous variants like rs199665292 in OR13C5, despite not changing the amino acid sequence, can affect function through several mechanisms: 1) Altered mRNA secondary structure affecting stability or processing, 2) Changed codon usage affecting translation efficiency, 3) Disruption of splicing enhancer or silencer elements, 4) Modification of miRNA binding sites, or 5) Effects on co-translational protein folding due to altered translation kinetics. The strong association of this synonymous variant with RSV susceptibility suggests it has functional consequences through one or more of these mechanisms, challenging the traditional view of synonymous mutations as "silent" .

What approaches could clarify the mechanism of OR13C5 in viral susceptibility?

Future research to clarify OR13C5's role in viral susceptibility should employ multi-omics approaches including: 1) Transcriptomic analysis to determine if the rs199665292 variant affects OR13C5 expression levels or splicing patterns, 2) Structural biology techniques to investigate potential interactions between OR13C5 and viral proteins, 3) CRISPR-Cas9 gene editing to create cellular models with different OR13C5 variants to test viral susceptibility directly, 4) Immunological assays to determine if OR13C5 variants affect innate immune responses, and 5) Broader population genetics studies to identify additional variants and potential gene-gene interactions affecting susceptibility .

How might OR13C5 research contribute to therapeutic development?

OR13C5 research could contribute to therapeutic development through several pathways: 1) Identification of individuals at high risk for severe RSV disease based on genetic screening, allowing for targeted prophylactic interventions, 2) Development of OR13C5 antagonists or modulators that could potentially block viral entry or replication if the receptor is directly involved in these processes, 3) Understanding the broader role of olfactory receptors in immunity, potentially revealing new therapeutic targets, and 4) Design of immunomodulatory approaches that account for the influence of OR13C5 variants on host response to infection .

What related genes warrant investigation based on OR13C5 findings?

The discovery of OR13C5's association with RSV susceptibility suggests investigation of related genes including: 1) Other olfactory receptors, particularly OR8U1/OR8U8 which showed association signals when rare variants were collapsed and weighted by pathogenicity, 2) Taste receptors like TAS2R19 that were also implicated in the RSV study, 3) Mucin genes (MUC4, MUC6) that showed significant associations and may interact with OR13C5 in respiratory epithelium, 4) HLA genes (HLA-DQA1, HLA-DPB1) that emerged as susceptibility candidates and may reveal immunological mechanisms connecting OR13C5 to viral defense, and 5) Other G-protein coupled receptors that share structural similarities with OR13C5 and may have undiscovered roles in infectious disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.