Recombinant Human Olfactory receptor 13C9 (OR13C9)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR13C9

OR13C9 belongs to the olfactory receptor (OR) family, a class of G-protein-coupled receptors (GPCRs) responsible for odorant detection . Key structural features include:

  • 7-transmembrane domain architecture: Characteristic of GPCRs, enabling odorant binding and signal transduction .

  • Sequence length: 318 amino acids in full-length recombinant forms .

  • Conserved motifs: Includes a TM3-TM6 interaction interface critical for receptor activation .

The recombinant version retains >80% sequence identity with mouse and rat orthologs, preserving cross-species functional relevance .

Odorant Response Profiling

Studies using recombinant OR13C9 have revealed:

  • Broad ligand promiscuity: Responds to n-aliphatic compounds with 6-12 carbon chains .

  • Dose-dependent activation: EC50 values typically in the micromolar range for primary odorants .

  • Calcium signaling dynamics: Exhibits rapid response kinetics (<100 ms) in HEK293-based assays .

Technical Considerations

Key experimental parameters for working with recombinant OR13C9:

ApplicationOptimal ConditionsCitation
Binding Assays100x molar excess of control peptide
Membrane LocalizationRequires RTP1/RTP2 chaperones
Signal DetectionGloSensor cAMP assay (ECL3-dependent)

Storage stability varies significantly between formulations, with lyophilized mammalian cell products maintaining activity for 12 months versus 6 months for E. coli-expressed variants .

Research Challenges and Solutions

Current limitations in OR13C9 research include:

  1. Low surface expression: Solved by Hana3A cell line modification .

  2. Signal quantification: Addressed through Ric-8B co-expression enhancing Gαolf activity .

  3. Odorant interference: Mitigated using single-OR sensor arrays .

Future Directions

Emerging applications leverage recombinant OR13C9 in:

  • Digital olfaction: Integration with CMOS-based biosensors .

  • Drug discovery: Screening for modulators of OR-mediated metabolic pathways .

  • Neuroscience tools: Optogenetic control of olfactory signaling pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR13C9; Olfactory receptor 13C9; Olfactory receptor OR9-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13C9
Target Protein Sequence
MEWENQTILVEFFLKGHSVHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTTECVLLGMMAF DRYVAICNPLRYPIIMSKNAYVPMAVGSWFAGIVNSAVQTTFVVQLPFCRKNVINHFSCE ILAVMKLACADISGNEFLMLVATILFTLMPLLLIVISYSLIISSILKIHSSEGRSKAFST CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN KDVKEAVKHLPNRRFFSK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15104

KEGG: hsa:286362

STRING: 9606.ENSP00000259362

UniGene: Hs.553682

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 13C9 and what is its classification?

Olfactory Receptor 13C9 (OR13C9) is a human odorant receptor encoded by the OR13C9 gene in the human genome. It belongs to the class A family of seven-transmembrane G protein-coupled receptors (GPCRs) . OR13C9 is also known by the synonym "Olfactory receptor OR9-13" and has the UniProt identifier Q8NGT0 . Like other olfactory receptors, it is involved in the initial detection of odorant molecules and signal transduction in the olfactory system. The receptor contains characteristic conserved domains common to the olfactory receptor family, along with regions of diversity that likely contribute to its specificity for certain odorants.

How does OR13C9 compare structurally with other human olfactory receptors?

Human olfactory receptor genes, including OR13C9, show high degrees of sequence similarity while maintaining specific variations that likely account for their differing ligand specificities . The conserved domains include the seven-transmembrane regions characteristic of GPCRs, with the third, fourth, and fifth transmembrane domains often containing residues critical for ligand binding. While specific structural comparison data for OR13C9 is limited, analysis of other human olfactory receptors suggests that sequence variations in these transmembrane domains and in the extracellular loops connecting them are responsible for differential odorant recognition patterns. AlphaFold structural predictions are available for OR13C9, which can provide insights into its three-dimensional conformation in the absence of crystallographic data .

What expression systems are suitable for recombinant OR13C9 production?

Based on successful expression of other human olfactory receptors, several expression systems can be considered for OR13C9:

  • HEK293 Cells: Human embryonic kidney 293 cells have been successfully used for functional expression of human olfactory receptors, as demonstrated with OR17-40 . This mammalian system provides appropriate post-translational modifications and cellular machinery for proper folding and trafficking of GPCRs.

  • Xenopus laevis Oocytes: This system has proven effective for functional expression of human olfactory receptors for electrophysiological studies . Co-expression with "reporter" channels allows measurement of receptor activation in response to odorants.

  • Wheat Germ Cell-Free System: Similar to what has been used for other olfactory receptors, this system can produce recombinant proteins suitable for biochemical and immunological studies, including ELISA and Western blot applications .

For functional studies, membrane targeting sequences may be required to improve surface expression, as demonstrated by the use of the 5-HT3 receptor membrane import sequence for other olfactory receptors .

What methodological approaches can verify functional expression of OR13C9?

Several complementary methods can verify functional expression:

  • Calcium Imaging: Measures odor-induced changes in intracellular Ca²⁺ concentration in cells expressing the receptor. This technique has successfully demonstrated functional expression of human olfactory receptors in HEK293 cells . The experimental protocol typically involves:

    • Loading cells with calcium-sensitive fluorescent dyes (e.g., Fura-2/AM)

    • Establishing baseline fluorescence

    • Applying potential odorants

    • Measuring transient increases in intracellular Ca²⁺

    • Using ATP (1mM) as a positive control to verify cellular response capability

  • Electrophysiological Recording: Particularly useful in Xenopus oocytes where co-expression with a reporter channel allows measurement of conductance changes in response to odorant application . This approach involves:

    • Two-electrode voltage clamp techniques

    • Measuring current signals in response to voltage ramps or steps

    • Calculating relative conductance in response to odorant application

  • Immunocytochemistry: Using epitope tags (such as c-myc) and corresponding antibodies to verify protein expression and localization to the plasma membrane .

How can ligand specificity of OR13C9 be determined experimentally?

Determining ligand specificity requires systematic screening approaches:

  • Mixture-to-Component Strategy: Begin with complex odor mixtures (like the Henkel 100 mixture used for OR17-40 ), then progressively subdivide into smaller groups to identify active components. This systematic approach involves:

    • Initial screening with diverse odorant mixtures

    • Testing subgroups of the active mixture

    • Narrowing down to individual components

    • Confirming with dose-response relationships

  • Structure-Activity Relationship Analysis: Once initial active ligands are identified, testing structurally related molecules can reveal the structural requirements for receptor activation. This approach has successfully identified helional and heliotroplyacetone as specific ligands for OR17-40, while structurally similar compounds like piperonal were ineffective .

  • Dose-Response Analysis: Determining EC50 values (concentration producing half-maximal response) for active ligands provides quantitative measures of binding affinity and allows comparison between different ligands.

MethodAdvantagesLimitationsData Output
Calcium ImagingReal-time visualization, cell population analysisIndirect measure of receptor activationCa²⁺ transient amplitude and kinetics
ElectrophysiologyDirect measurement of channel activity, high temporal resolutionTechnical complexity, single-cell analysisCurrent amplitude, conductance changes
Competitive BindingDirect measure of ligand-receptor interactionRequires radiolabeled or fluorescent ligandsBinding affinity (Kd), competition curves

How can the binding pocket of OR13C9 be characterized through mutagenesis?

Characterizing the binding pocket requires a systematic mutagenesis approach:

  • Homology-Based Prediction: Using the AlphaFold structural predictions for OR13C9 and knowledge from other characterized olfactory receptors to identify candidate residues likely involved in ligand binding.

  • Site-Directed Mutagenesis Strategy:

    • Focus on residues in transmembrane domains 3, 4, and 5, which often form the binding pocket in GPCRs

    • Generate point mutations changing amino acid properties (e.g., hydrophobic to polar)

    • Express mutant receptors in functional assay systems like HEK293 cells

    • Test responses to identified ligands

  • Alanine Scanning: Systematically replace candidate residues with alanine to identify which amino acids are critical for ligand recognition versus structural integrity.

  • Chimeric Receptor Approach: Creating chimeric receptors between OR13C9 and closely related receptors with different ligand specificities can help identify regions responsible for ligand selectivity.

The experimental workflow should include validation of proper expression for each mutant using immunocytochemistry or surface biotinylation assays to ensure that changes in function are not due to trafficking defects.

What signaling pathways are activated downstream of OR13C9, and how can they be studied?

As a GPCR, OR13C9 likely signals through G protein-dependent pathways:

  • G Protein Coupling Identification:

    • Most olfactory receptors couple to Gαolf (stimulatory G protein)

    • This activates adenylyl cyclase, increasing cAMP production

    • cAMP opens cyclic nucleotide-gated channels, leading to Ca²⁺ influx

  • Experimental Approaches to Study Signaling:

    • cAMP measurements using FRET-based sensors or enzyme immunoassays

    • Calcium imaging with and without specific pathway inhibitors

    • Co-immunoprecipitation to identify interacting proteins

    • siRNA knockdown of signaling components to verify pathway components

  • Validating Pathway Specificity:

    • Pharmacological inhibitors (e.g., SQ22536 for adenylyl cyclase inhibition)

    • Expression of dominant-negative G protein subunits

    • IBMX (phosphodiesterase inhibitor) can be used to potentiate cAMP-mediated responses, as demonstrated in oocyte expression systems

Results should be compared with existing models of olfactory signal transduction to identify any receptor-specific signaling characteristics.

What techniques can address the challenges of low expression levels of recombinant OR13C9?

Olfactory receptors, including OR13C9, often show low surface expression in heterologous systems due to inefficient folding and trafficking. Several strategies can improve expression:

  • Expression Enhancement Strategies:

    • Addition of N-terminal signal sequences (like the 5-HT3 receptor sequence used for OR17-40 )

    • Codon optimization for the expression system

    • Use of chemical chaperones (e.g., glycerol, DMSO) during expression

    • Lower expression temperature (e.g., 30°C instead of 37°C for mammalian cells)

    • Co-expression with receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs)

  • Purification Optimization:

    • Detergent screening to identify optimal solubilization conditions

    • Addition of stabilizing ligands during purification

    • Use of specialized tags (e.g., MBP, SUMO) that enhance solubility

  • Detection Enhancement:

    • Incorporation of epitope tags (e.g., c-myc ) for sensitive immunodetection

    • Development of high-affinity antibodies specific to OR13C9

    • Use of fluorescent protein fusions for direct visualization

Each strategy should be validated to ensure the receptor retains its native functionality and ligand binding properties.

How should experimental controls be designed for OR13C9 functional studies?

Robust experimental controls are critical for reliable OR13C9 research:

  • Negative Controls:

    • Mock-transfected cells (transfection reagents without receptor DNA)

    • Cells expressing unrelated receptors to control for non-specific responses

    • Application of vehicle solutions without odorants

    • Testing structurally similar but inactive compounds

  • Positive Controls:

    • ATP application (1mM) to verify cellular response capability through endogenous P2Y receptors

    • Expression of well-characterized olfactory receptors with known ligands

    • Application of calcium ionophores to verify calcium imaging methodology

    • For co-expression systems, verification of reporter channel function

  • System Validation:

    • Verification of protein expression using Western blotting or immunocytochemistry

    • Confirmation of plasma membrane localization

    • Dose-response relationships with known ligands to verify sensitivity

    • Reproducibility across multiple independent transfections or expression batches

These controls help distinguish specific receptor-mediated responses from non-specific cellular effects and technical artifacts.

How can contradictory findings in OR13C9 research be reconciled?

Contradictory findings may arise from methodological differences or biological variability:

  • Systematic Comparison Approach:

    • Standardize experimental conditions across laboratories

    • Create shared positive and negative control datasets

    • Develop reference standards for ligand preparation and application

    • Establish consensus protocols for data analysis and reporting

  • Source of Variability Analysis:

    • Expression system differences (e.g., HEK293 cells vs. oocytes)

    • Receptor construct variations (tags, fusion proteins)

    • Differences in signaling pathway coupling efficiency

    • Odorant preparation methods and purity

  • Integrated Data Analysis:

    • Meta-analysis of published datasets

    • Statistical approaches to identify consistent effects across studies

    • Bayesian analysis incorporating prior probability of effects

  • Collaborative Resolution Strategies:

    • Multi-laboratory studies using identical protocols

    • Round-robin testing of reagents and cell lines

    • Development of standardized positive controls and reference ligands

Addressing contradictions often leads to deeper understanding of receptor biology and improved experimental design.

What statistical approaches are appropriate for analyzing OR13C9 ligand screening data?

  • Dose-Response Analysis:

    • Nonlinear regression to fit sigmoidal dose-response curves

    • Determination of EC50 values with confidence intervals

    • Calculation of maximal efficacy (Emax) for each ligand

    • Statistical comparison of curve parameters across ligands

  • High-Throughput Screening Analysis:

    • Z-factor calculation to assess assay quality

    • Signal-to-background ratio optimization

    • False discovery rate control for multiple comparisons

    • Receiver operating characteristic (ROC) curve analysis

  • Structure-Activity Relationship Statistics:

    • Principal component analysis of molecular descriptors

    • Hierarchical clustering of active vs. inactive compounds

    • Quantitative structure-activity relationship (QSAR) modeling

    • Pharmacophore model development and validation

  • Reproducibility Metrics:

    • Coefficient of variation across replicates

    • Intra-class correlation coefficients

    • Power analysis for sample size determination

    • Bootstrapping for robust confidence interval estimation

Statistical ApproachApplicationOutput MetricsInterpretation
Nonlinear RegressionDose-response analysisEC50, Hill slope, EmaxPotency, cooperativity, efficacy
Z-factorAssay quality assessmentZ-factor value (0-1)>0.5 indicates excellent assay
PCAStructural determinant analysisPrincipal components, variance explainedKey molecular features for activity
BootstrappingConfidence interval estimation95% CI, resampling distributionRobustness of parameter estimates

How can OR13C9 research contribute to understanding olfactory coding mechanisms?

OR13C9 research can provide valuable insights into olfactory coding:

These approaches can contribute to the broader understanding of how the hundreds of different human olfactory receptors work together to encode odor identities.

What novel methodology developments could advance OR13C9 research?

Future methodological advances may include:

  • Advanced Imaging Techniques:

    • Single-molecule imaging to study receptor dynamics

    • FRET-based sensors to directly measure ligand-receptor interactions

    • Super-resolution microscopy to visualize receptor clustering and organization

  • Computational Approaches:

    • Machine learning algorithms for predicting novel ligands

    • Molecular dynamics simulations of ligand binding

    • Systems biology models integrating receptor activation with downstream signaling

  • Genetic Engineering Innovations:

    • CRISPR/Cas9 modification of endogenous OR13C9 in olfactory sensory neurons

    • Development of inducible expression systems for temporal control of receptor expression

    • Creation of humanized mouse models expressing OR13C9 in defined olfactory neurons

These technical innovations will facilitate more detailed investigations of OR13C9 function and integration into the olfactory system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.