Recombinant Human Olfactory receptor 13F1 (OR13F1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Olfactory Receptor 13F1 (OR13F1)

Recombinant Human Olfactory Receptor 13F1 (OR13F1) is a synthetic protein derived from the human OR13F1 gene, which encodes a member of the G-protein-coupled receptor (GPCR) family. OR13F1 belongs to the olfactory receptor subfamily 13F and is structurally characterized by seven transmembrane domains, a hallmark of GPCRs. While its native function involves odorant detection, the recombinant form is engineered for research purposes, enabling studies on receptor-ligand interactions, signaling mechanisms, and potential therapeutic applications .

PropertyDetails
Gene NameOR13F1
UniProt IDQ8NGS4
SynonymsOlfactory receptor 13F1, OR9-6
Protein LengthPartial (exact length varies by expression system)
Expression SystemsE. coli, yeast, baculovirus, mammalian cells
Purity>85% (SDS-PAGE)
BufferTris/PBS-based with 6% trehalose
Storage-20°C/-80°C (lyophilized)

Production and Purification Methods

OR13F1 is synthesized using diverse recombinant systems, each with distinct advantages:

SystemAdvantagesLimitations
E. coliHigh yield, low costLimited post-translational modifications
YeastEnhanced folding for eukaryotic proteinsLower throughput
BaculovirusProper membrane integrationComplex process
Mammalian cellsNative-like folding and modificationsHigh cost, low yield

Purification typically involves affinity chromatography (e.g., His-tagged variants) followed by lyophilization. The final product is stabilized with trehalose to prevent degradation during storage .

Research Applications and Findings

While OR13F1 remains an orphan receptor (no identified ligands), its recombinant form supports studies in:

  1. Olfactory Signaling: Investigating receptor activation mechanisms in heterologous systems (e.g., Hana3A cells) .

  2. Cancer Biology: Exploring ectopic OR expression in tumors, though OR13F1 has not been directly implicated in malignancy .

  3. Biotechnology: Screening for odorant ligands using high-throughput assays, though ligand identification remains a challenge .

Key Challenges

  • Ligand Deorphanization: OR13F1’s odorant specificity is unknown due to the vast chemical diversity of potential ligands .

  • Functional Validation: Receptor activity is often inferred from homologous OR studies (e.g., OR2B6 in breast cancer) .

Future Directions and Challenges

  1. Deorphanization Efforts: Systematic screening of odorant libraries to identify OR13F1 agonists/antagonists .

  2. Structural Studies: Cryo-EM or NMR to resolve receptor conformational changes during activation.

  3. Therapeutic Potential: Evaluating OR13F1 as a biomarker or drug target, contingent on functional studies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
OR13F1; Olfactory receptor 13F1; Olfactory receptor OR9-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13F1
Target Protein Sequence
MFPANWTSVKVFFFLGFFHYPKVQVIIFAVCLLMYLITLLGNIFLISITILDSHLHTPMY LFLSNLSFLDIWYSSSALSPMLANFVSGRNTISFSGCATQMYLSLAMGSTECVLLPMMAY DRYVAICNPLRYPVIMNRRTCVQIAAGSWMTGCLTAMVEMMSVLPLSLCGNSIINHFTCE ILAILKLVCVDTSLVQLIMLVISVLLLPMPMLLICISYAFILASILRISSVEGRSKAFST CTAHLMVVVLFYGTALSMHLKPSAVDSQEIDKFMALVYAGQTPMLNPIIYSLRNKEVKVA LKKLLIRNHFNTAFISILK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14723

KEGG: hsa:138805

STRING: 9606.ENSP00000334452

UniGene: Hs.553602

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 13F1 and what is its genomic location?

Olfactory Receptor 13F1 (OR13F1) is a G protein-coupled receptor that belongs to the olfactory receptor family. These receptors are responsible for the detection of odor molecules and the initiation of neuronal responses that lead to the perception of smell. The OR13F1 gene is located on chromosome 9q31.1 in humans . Like other olfactory receptors, OR13F1 plays a crucial role in the detection and discrimination of various odorants, contributing to the complex process of olfactory perception.

How does OR13F1 compare structurally to other olfactory receptors?

OR13F1, like other olfactory receptors, has a seven-transmembrane domain structure characteristic of G protein-coupled receptors. While specific structural data for OR13F1 is limited in the provided search results, we can compare it with the related olfactory receptor OR13A1, which consists of 328 amino acids with a molecular weight of approximately 39.3 kD . The structural features typically include extracellular N-terminus, seven alpha-helical transmembrane domains, intracellular C-terminus, and binding pockets for odorant molecules. These structural elements are critical for the receptor's function in recognizing specific odorant molecules and transducing signals.

How can CRISPR activation systems be utilized to study OR13F1 function?

CRISPR activation systems offer a powerful approach for OR13F1 functional studies. The OR13F1 CRISPR Activation Plasmid utilizes a synergistic activation mediator (SAM) transcription activation system designed to upregulate endogenous OR13F1 gene expression . This system employs:

  • A deactivated Cas9 (dCas9) nuclease (with D10A and N863A mutations) fused to a VP64 activation domain

  • A target-specific sgRNA engineered to bind the MS2-P65-HSF1 fusion protein

  • The MS2-P65-HSF1 complex that serves as a transcriptional activator

This approach allows researchers to study OR13F1 function in its native genomic context without introducing exogenous copies of the gene, preserving natural regulation mechanisms and providing insights into physiological function . The method is particularly valuable for studying genes like OR13F1 that may be difficult to express using traditional recombinant systems.

What challenges are associated with functional characterization of OR13F1?

Functional characterization of OR13F1 presents several significant challenges:

  • Expression difficulties: Olfactory receptors are notoriously difficult to express in heterologous systems due to their hydrophobic nature and complex folding requirements.

  • Ligand identification: Determining the specific odorant molecules that activate OR13F1 requires systematic screening approaches, as olfactory receptors can respond to multiple ligands with varying affinities.

  • Functional assay development: Developing reliable assays that can detect the typically transient and sometimes weak signals generated upon receptor activation.

  • Protein stability issues: Maintaining the stability of the receptor during purification and characterization, as olfactory receptors tend to denature easily when removed from their native membrane environment.

  • Physiological relevance: Correlating in vitro findings with the physiological role of OR13F1 in the olfactory system.

These challenges necessitate multidisciplinary approaches combining molecular biology, biochemistry, and computational techniques to achieve comprehensive functional characterization.

How does experimental design affect OR13F1 research outcomes?

Experimental design is crucial in OR13F1 research and should consider several factors to ensure reliable outcomes:

  • Selection of appropriate controls: Including both positive and negative controls specific to olfactory receptor signaling pathways.

  • Tag placement considerations: N-terminal tags (such as 10xHis tags used in related receptor studies) may impact receptor function differently than C-terminal tags .

  • Buffer composition: The storage buffer composition significantly affects protein stability—Tris/PBS-based buffers with 5%-50% glycerol are commonly used for liquid formulations .

  • Expression region selection: Ensuring the expression construct contains the full coding sequence (amino acids 1-328 for related olfactory receptors) is essential for proper protein function .

  • Reconstitution protocols: For lyophilized proteins, proper reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol is recommended to maintain stability .

  • Storage conditions: Preventing repeated freeze-thaw cycles and storing working aliquots at 4°C for short-term use while maintaining long-term stocks at -20°C/-80°C .

Careful attention to these details can significantly improve experimental reproducibility and data quality in OR13F1 research.

What machine learning approaches can enhance OR13F1 functional data analysis?

Machine learning approaches can significantly enhance the analysis of OR13F1 functional data through:

  • Random Forest algorithms: These can be employed to identify important features in OR13F1 expression data and find pathways related to OR13F1 function . Random forests are particularly useful for dealing with high-dimensional data typical in receptor studies.

  • Dimensionality reduction methods: Techniques such as Principal Component Analysis (PCA), Stochastic Neighbor Embedding (SNE), and Diffusion Maps can visualize complex relationships between OR13F1 and other genes .

  • Feature selection: This approach helps identify the most informative genes or pathways associated with OR13F1 function, reducing noise and improving model performance .

  • Functional visualization: Machine learning can help visualize the functional relationships between OR13F1 and other genes based on Gene Ontology (GO) annotations, providing insights into biological processes involving OR13F1 .

The application of these methods requires careful data preprocessing, cross-validation strategies, and validation of findings using experimental approaches.

How can researchers reconcile contradictory data in OR13F1 studies?

When faced with contradictory data in OR13F1 studies, researchers should:

By systematically addressing these factors, researchers can develop a more coherent understanding of OR13F1 function despite initial data contradictions.

What computational tools are recommended for OR13F1 structure prediction?

While specific computational tools for OR13F1 were not detailed in the search results, the following approaches are recommended for olfactory receptor structure prediction:

  • Homology modeling: Using structures of related GPCRs as templates for modeling OR13F1 structure.

  • Molecular dynamics simulations: For refining structural models and investigating dynamic properties of the receptor.

  • Docking simulations: To predict potential ligand binding sites and interactions.

  • Machine learning-based prediction tools: Leveraging advances in AI for protein structure prediction, particularly those trained on membrane protein datasets.

  • Integration with experimental data: Combining computational predictions with limited experimental data such as mutagenesis results to constrain and validate models.

These computational approaches can provide valuable structural insights when experimental structure determination is challenging, as is typically the case with olfactory receptors.

What are the recommended protocols for purifying recombinant OR13F1?

Based on protocols for similar olfactory receptors, the recommended purification process for recombinant OR13F1 includes:

  • Centrifugation preparation: Briefly centrifuge the protein vial prior to opening to bring the contents to the bottom .

  • Tag-based purification: Utilize the N-terminal His-tag (10xHis-tag in related receptors) for affinity chromatography purification .

  • Buffer optimization: Employ Tris/PBS-based buffers with 5%-50% glycerol for liquid formulations to maintain protein stability .

  • Reconstitution protocol: For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of 5-50% glycerol (final concentration) .

  • Aliquoting strategy: Divide the purified protein into small aliquots to avoid repeated freeze-thaw cycles .

  • Quality control: Verify purity using SDS-PAGE (aiming for >85% purity) and assess functionality through appropriate binding or signaling assays .

  • Storage conditions: Store working aliquots at 4°C for up to one week and long-term storage at -20°C/-80°C with appropriate cryoprotectants .

These protocols help maintain the structural integrity and functional activity of the purified recombinant OR13F1 protein.

What approaches are effective for validating OR13F1 expression in heterologous systems?

Effective validation of OR13F1 expression in heterologous systems should include multiple complementary approaches:

  • Western blotting: Using antibodies against either the OR13F1 protein or the affinity tag (such as the His-tag) to confirm protein expression at the expected molecular weight.

  • Immunofluorescence microscopy: To verify proper cellular localization of the receptor to the plasma membrane.

  • Flow cytometry: For quantitative assessment of cell surface expression levels.

  • Functional assays: Measuring receptor activation upon ligand binding using calcium imaging, cAMP assays, or reporter gene assays.

  • Mass spectrometry: For definitive identification and characterization of the expressed protein.

  • Surface plasmon resonance (SPR): To assess binding properties of the purified receptor to potential ligands.

A combination of these approaches provides comprehensive validation of both expression and functionality of the recombinant OR13F1 protein.

How can OR13F1 be incorporated into high-throughput functional screening assays?

Incorporating OR13F1 into high-throughput functional screening assays can be achieved through:

  • Cell-based reporter systems: Developing stable cell lines expressing OR13F1 coupled to downstream reporters such as luciferase or fluorescent proteins.

  • CRISPR activation systems: Using the OR13F1 CRISPR Activation Plasmid to upregulate endogenous OR13F1 expression in relevant cell types for screening .

  • Calcium flux assays: Employing calcium-sensitive dyes in OR13F1-expressing cells plated in 384-well formats for automated screening.

  • Impedance-based detection: Using label-free technologies that measure cellular responses to receptor activation in real-time.

  • Bioluminescence resonance energy transfer (BRET): Creating OR13F1 fusion constructs to monitor conformational changes upon ligand binding.

  • Miniaturized membrane preparations: Developing receptor-containing membrane dots for binding assays in high-density formats.

These approaches enable efficient screening of large compound libraries for potential OR13F1 ligands or modulators while minimizing reagent consumption and experimental time.

How can pathway analysis be applied to understand OR13F1's role in cellular function?

Pathway analysis can provide crucial insights into OR13F1's biological roles through:

  • Gene Ontology (GO) analysis: Examining GO terms associated with OR13F1 to understand its biological processes, molecular functions, and cellular components .

  • Finding functional relationships: Using similarity measures such as information content (IC) and hop-based metrics to identify functional relationships between OR13F1 and other genes .

  • Principal Component Analysis (PCA): Applying PCA to visualize relationships between OR13F1 and other genes based on functional annotations .

  • Correlation analysis: Identifying GO terms with high correlation to principal components to understand the biological functions associated with OR13F1 .

  • Pathway enrichment analysis: Determining which biological pathways are statistically overrepresented in gene sets functionally related to OR13F1.

  • Protein-protein interaction networks: Mapping known interactions to identify potential signaling complexes involving OR13F1.

These approaches can reveal unexpected functions and connections for OR13F1 beyond its canonical role in olfaction, potentially identifying novel research directions.

What is known about the interaction of OR13F1 with signaling pathways?

While specific information about OR13F1 signaling is limited in the provided search results, olfactory receptors typically interact with several key signaling pathways:

  • G protein signaling: OR13F1, like other olfactory receptors, likely couples to G proteins (particularly Golf) to initiate downstream signaling.

  • cAMP pathway: Activation leads to increased adenylyl cyclase activity, elevated cAMP levels, and subsequent opening of cyclic nucleotide-gated channels.

  • Calcium signaling: The influx of calcium through opened channels triggers additional signaling events and may activate calcium-dependent chloride channels.

  • MAPK pathway: Some olfactory receptors have been shown to activate the MAPK pathway, potentially linking OR13F1 to cell growth and differentiation processes.

  • β-arrestin pathway: Like other GPCRs, OR13F1 likely undergoes desensitization through β-arrestin recruitment, which may also initiate additional signaling cascades.

Understanding these signaling pathways is crucial for interpreting functional data and developing effective assays for OR13F1 characterization.

What are the critical quality control parameters for recombinant OR13F1 preparations?

Critical quality control parameters for recombinant OR13F1 preparations include:

ParameterRecommended StandardMethod of AssessmentImportance
Purity>85%SDS-PAGEEnsures reliable experimental results
Protein concentration0.1-1.0 mg/mLBradford/BCA assayCritical for consistent dosing in experiments
Tag integrityComplete tag sequenceWestern blotEnsures purification efficiency
Endotoxin levelsBelow detection limitLAL assayPrevents inflammation in cellular assays
Secondary structureProper foldingCircular dichroismIndicates functional potential
Aggregation stateMonodisperseDynamic light scatteringAffects binding properties
Glycerol content5-50%Validated formulationMaintains stability during storage
Functional activityLigand bindingSpecific binding assaysConfirms biological relevance

Rigorous quality control using these parameters ensures that experimental results are reliable and reproducible, addressing a common challenge in olfactory receptor research.

How do post-translational modifications affect OR13F1 function?

Post-translational modifications (PTMs) can significantly impact OR13F1 function in several ways:

  • N-linked glycosylation: May affect receptor trafficking to the cell membrane and stability in the membrane environment. While specific data for OR13F1 is not provided in the search results, E. coli expression systems (as used for related receptors) do not perform these modifications, potentially affecting protein properties .

  • Palmitoylation: Likely occurs on cysteine residues and can influence receptor localization to lipid rafts and signaling efficiency.

  • Phosphorylation: May regulate receptor desensitization and internalization following activation.

  • Ubiquitination: Controls receptor degradation and turnover rates.

  • Disulfide bond formation: Critical for maintaining the proper three-dimensional structure of the receptor.

The expression system choice significantly impacts these modifications—E. coli systems (as mentioned for related receptors) lack the machinery for many eukaryotic PTMs , while mammalian or insect cell systems better recapitulate the natural modification pattern. Researchers must consider these factors when interpreting functional data from different expression systems.

What storage conditions optimize OR13F1 stability?

Based on recommendations for similar olfactory receptors, optimal storage conditions for OR13F1 include:

  • Temperature requirements:

    • Long-term storage: -20°C/-80°C

    • Working aliquots: 4°C for up to one week

  • Buffer composition:

    • Liquid form: Tris/PBS-based buffer with 5%-50% glycerol

    • Lyophilized form: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 before lyophilization

  • Cryoprotectant requirements:

    • Glycerol (5-50% final concentration) is recommended to prevent freeze-thaw damage

    • Default final concentration of 50% glycerol is commonly used

  • Aliquoting strategy:

    • Divide into small single-use aliquots to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • For lyophilized protein, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Shelf life expectations:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C

Adhering to these storage conditions maximizes protein stability and extends the usable lifetime of recombinant OR13F1 preparations.

How might single-cell sequencing advance our understanding of OR13F1 expression patterns?

Single-cell sequencing technologies offer powerful new approaches to understand OR13F1 expression:

  • Cell-type specific expression patterns: Revealing whether OR13F1 is expressed exclusively in specific olfactory sensory neuron populations or more broadly across cell types.

  • Developmental trajectory analysis: Mapping how OR13F1 expression changes during olfactory system development and neuronal maturation.

  • Co-expression networks: Identifying genes consistently co-expressed with OR13F1, providing insights into functional relationships and regulatory mechanisms.

  • Expression heterogeneity: Quantifying cell-to-cell variation in OR13F1 expression levels within apparently homogeneous populations.

  • Spatial transcriptomics: Combining single-cell sequencing with spatial information to map OR13F1 expression across the olfactory epithelium.

These approaches can reveal unexpected expression patterns of OR13F1 outside the olfactory system, potentially expanding our understanding of its biological roles beyond olfaction.

What emerging technologies might overcome current limitations in OR13F1 research?

Several emerging technologies show promise for addressing current challenges in OR13F1 research:

  • Cryo-electron microscopy: Advancing structural determination of membrane proteins without crystallization, potentially revealing OR13F1's three-dimensional structure.

  • CRISPR activation/interference systems: Enabling precise manipulation of OR13F1 expression in native contexts through technologies like the OR13F1 CRISPR Activation Plasmid .

  • Nanobody development: Creating small antibody-like proteins that can stabilize OR13F1 in specific conformations for structural and functional studies.

  • Microfluidic organ-on-chip models: Developing more physiologically relevant systems to study OR13F1 function in tissue-like environments.

  • Deep learning algorithms: Improving prediction of OR13F1 ligands through advanced computational approaches that integrate multiple data types.

  • Single-molecule imaging techniques: Allowing direct visualization of OR13F1 interactions with ligands and downstream signaling components in real-time.

These technologies collectively promise to overcome the significant technical barriers that have historically limited olfactory receptor research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.