Recombinant Human Olfactory receptor 13G1 (OR13G1)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Genomic Context

The OR13G1 gene is located on human chromosome 1 (1q44) and spans approximately 8,927 base pairs. It contains two exons and encodes a protein of 307 amino acids .

FeatureDetail
Chromosomal Location1q44
Exon Count2
Protein Length307 amino acids
Gene TypeProtein-coding

OR13G1 belongs to the odorant receptor family 13, subfamily G, which includes receptors dedicated to detecting structurally related odorants . The gene’s genomic organization and protein-coding structure are characteristic of the broader olfactory receptor gene family, the largest in the human genome .

Recombinant Expression and Purification

Recombinant OR13G1 is typically expressed in heterologous systems (e.g., HEK293S cells) with epitope tags (e.g., FLAG, rho1D4) to enable purification . Key methodologies include:

  1. Expression: Tetracycline-inducible systems for controlled protein production.

  2. Purification:

    • Immunoaffinity chromatography: Using anti-FLAG antibodies.

    • Size exclusion chromatography (SEC): Separates monomeric (~1.6 mg) and dimeric (~1.1 mg) forms .

  3. Validation:

    • Circular dichroism (CD): Confirms proper folding.

    • Fluorescence assays: Measures ligand binding (e.g., dihydrojasmone in homologous receptors) .

StepMethodOutcome
Expression SystemHEK293S cells + tetracycline inductionHigh-yield protein production
PurificationAnti-FLAG chromatography + SECMonomeric (1.6 mg) and dimeric (1.1 mg)
Structural ValidationCD spectroscopyProper folding confirmed
Ligand Binding AssayTryptophan fluorescence (homologs)Micromolar affinity for cognate ligands

Functional Insights and Ligand Specificity

While no physiological ligands are explicitly identified for OR13G1 , studies on homologous receptors (e.g., hOR1A1) suggest:

  • Odorant Recognition: Subfamily-specific detection of aliphatic or aromatic compounds .

  • Signal Transduction: G-protein-mediated activation of cAMP pathways .

The lack of direct ligand data for OR13G1 underscores the need for further research, though structural similarities to subfamily members imply potential roles in detecting specific odorant classes .

Applications in Research and Biotechnology

Recombinant OR13G1 serves as a model for:

  1. Olfactory Perception Studies: Elucidating combinatorial coding mechanisms where multiple receptors detect overlapping odorants .

  2. Biotechnological Tools: Engineering odor-sensing devices for environmental monitoring or food quality control.

  3. Drug Discovery: Targeting GPCRs for therapeutic interventions, leveraging structural insights from purified receptors .

Challenges and Future Directions

Key hurdles include:

  • Ligand Identification: Limited functional data due to the receptor’s specificity and low binding affinity.

  • Structural Resolution: NMR or crystallography studies are hindered by the receptor’s instability in detergents .

Future work should focus on high-throughput screening for ligands and cryo-EM structural characterization to advance functional understanding.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
OR13G1; Olfactory receptor 13G1; Olfactory receptor OR1-37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13G1
Target Protein Sequence
MNHSVVTEFIILGLTKKPELQGIIFLFFLIVYLVAFLGNMLIIIAKIYNNTLHTPMYVFL LTLAVVDIICTTSIIPKMLGTMLTSENTISYAGCMSQLFLFTWSLGAEMVLFTTMAYDRY VAICFPLHYSTIMNHHMCVALLSMVMAIAVTNSWVHTALIMRLTFCGPNTIDHFFCEIPP LLALSCSPVRINEVMVYVADITLAIGDFILTCISYGFIIVAILRIRTVEGKRKAFSTCSS HLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPMVYSFQNREMQAGIRK VFAFLKH
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19709766
  2. Observational study of gene-disease association. (HuGE Navigator) PMID: 19023099
  3. Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator) PMID: 19166692
  4. Observational study of gene-disease association. (HuGE Navigator) PMID: 19056482
  5. Observational study of gene-disease association. (HuGE Navigator) PMID: 17975119
  6. Observational study of gene-disease association. (HuGE Navigator) PMID: 18599554
  7. Observational study of gene-disease association. (HuGE Navigator) PMID: 16175505
Database Links

HGNC: 14999

OMIM: 611677

KEGG: hsa:441933

STRING: 9606.ENSP00000352717

UniGene: Hs.553834

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of OR13G1?

OR13G1 (Olfactory receptor family 13 subfamily G member 1, also known as OR1-37) is a G-protein-coupled receptor (GPCR) that belongs to the largest gene family in the human genome. Like other olfactory receptors, OR13G1 features a characteristic 7-transmembrane domain structure similar to many neurotransmitter and hormone receptors. This receptor interacts with odorant molecules in the nose to initiate neuronal responses that trigger smell perception. OR13G1 arises from a single coding-exon gene and is responsible for the recognition and G protein-mediated transduction of odorant signals . The protein functions by binding specific odorant molecules, which leads to conformational changes that activate associated G proteins, ultimately resulting in the generation of action potentials that transmit smell information to the brain.

How is recombinant OR13G1 typically produced for research purposes?

Recombinant OR13G1 can be produced using heterologous expression systems similar to those used for other olfactory receptors. The most common approach involves molecular cloning of the OR13G1 gene into expression vectors, followed by transfection into suitable host cells. The gene sequence is typically amplified using PCR with target gene-specific forward and reverse primers, and then inserted into appropriate expression vectors such as pME18S . For optimal expression, the construct often includes N-terminal epitope tags (such as FLAG) and the first 20 N-terminal amino acids of bovine rhodopsin, which has been shown to enhance surface expression of olfactory receptors . Cell-free expression systems may also be used for production of the full-length protein, similar to the approach used for other olfactory receptors . Purification typically involves affinity chromatography targeting the epitope tags, followed by verification of purity using SDS-PAGE.

Which cell lines are most suitable for functional expression of recombinant OR13G1?

While HEK293 cells are traditionally used for heterologous expression of olfactory receptors, they may not be optimal for all ORs, including OR13G1. Research indicates that certain cell lines like LNCaP can functionally express specific olfactory receptors that may not function well in HEK293 cells . When expressing OR13G1, it is advisable to co-transfect with accessory factors that enhance functional expression, including RTP1S (receptor-transporting protein 1S) and Gαolf (the G protein alpha subunit specific to olfactory signaling). The choice of cell line should consider the intrinsic basal activity of OR13G1 and the cellular environment that best supports its functional expression. For functional analysis, the cell line should allow for effective coupling of the receptor to downstream signaling pathways, which can be monitored using reporter systems such as CRE/luc2P for cAMP-dependent luciferase expression .

What are the most effective methods for determining OR13G1 ligand specificity?

Determining the ligand specificity of OR13G1 requires a systematic approach combining high-throughput screening and validation experiments. Initial screening can be performed by expressing OR13G1 in a suitable cell line (such as LNCaP or HEK293) along with a luciferase reporter system under the control of a cAMP-responsive element (CRE) . Cells are then exposed to potential odorants or odorant mixtures at various concentrations, and receptor activation is measured by luciferase activity. A fold-increase calculation, where the signal from stimulated cells is divided by that from non-stimulated cells expressing the same receptor, can be used to quantify responses .

For validation and detailed characterization, dose-response analyses should be conducted with candidates identified in the initial screening. Statistical significance should be determined by comparing responses from OR13G1-expressing cells to both unstimulated OR13G1-expressing cells and vector-transfected control cells stimulated with the same odorant concentration (using methods such as Sidak-Bonferroni with alpha = 5.0%) . Cross-reactivity testing with structurally diverse odorants is essential to establish specificity. Additionally, molecular modeling based on the predicted structure of OR13G1 can provide insights into the binding pocket and guide the design of structure-activity relationship studies.

How can reporter gene assays be optimized for studying OR13G1 activation?

Optimizing reporter gene assays for OR13G1 requires careful consideration of several factors. The reporter construct should incorporate a promoter element responsive to the OR13G1 signaling pathway, typically containing a cAMP-responsive element (CRE) . When designing the assay, both transcriptional and translational reporter fusions should be considered. For transcriptional fusions, the reporter gene is inserted behind the ribosome binding site and start codon, while translational fusions can be generated at various positions of the OR13G1 open reading frame .

To enhance signal-to-noise ratio, normalize the primary reporter signal (e.g., firefly luciferase) to a constitutively expressed secondary reporter (e.g., Renilla luciferase from pRL-CMV) . The transfection protocol should be optimized for efficiency while minimizing cellular stress, and expression levels should be verified by Western blotting or flow cytometry. Include positive controls (receptors with known ligands) and negative controls (empty vector transfections) in each experiment. For kinetic studies, consider using real-time reporter systems that allow continuous monitoring of receptor activation. The assay conditions, including cell density, incubation times, and buffer composition, should be systematically optimized for OR13G1 specifically, as conditions optimal for other olfactory receptors may not be ideal for OR13G1.

What approaches can resolve discrepancies between in vitro and in vivo responses of OR13G1?

Discrepancies between in vitro and in vivo responses of OR13G1 can be addressed through a multifaceted approach. First, compare the cellular environments by analyzing the expression profiles of accessory proteins, G proteins, and downstream signaling components in heterologous systems versus native olfactory sensory neurons (OSNs). Consider using primary cultures of OSNs or OSN-derived cell lines that more closely mimic the native environment .

Develop more physiologically relevant assay systems by incorporating nasal mucus components or odorant binding proteins that may modulate ligand accessibility and receptor function in vivo. Use calcium imaging or electrophysiological recordings from individual OSNs expressing OR13G1 to directly compare with heterologous expression systems. For in vivo validation, consider generating transgenic models with fluorescently tagged OR13G1 to track expression and function in the native environment.

Computational approaches can also help bridge the gap between in vitro and in vivo observations. Develop mathematical models that account for differences in membrane composition, receptor density, and coupling efficiency between systems. Finally, consider the temporal dynamics of receptor activation, as in vitro systems typically measure acute responses while in vivo perception involves adaptation and sensitization processes that occur over varying timescales.

How can mutagenesis studies be designed to identify critical residues in OR13G1?

Designing effective mutagenesis studies for OR13G1 requires a strategic approach targeting key functional domains. Begin with sequence alignment analysis comparing OR13G1 to well-characterized olfactory receptors to identify conserved and divergent residues. Focus on the transmembrane domains, particularly TM3, TM5, and TM6, which typically form the ligand-binding pocket in GPCRs . Use predictive algorithms and homology modeling to identify potential ligand-interaction sites.

For systematic analysis, employ alanine-scanning mutagenesis across predicted binding pocket residues, followed by more targeted substitutions based on initial results. When amplifying the OR13G1 gene, ensure any unknown missense mutations are modified to reference sequences before insertion into expression vectors . Generate receptor mutants using site-directed mutagenesis and verify sequence integrity before functional testing.

Evaluate mutant receptors using standardized functional assays as described in section 2.1, comparing EC50 values, maximal responses, and basal activity to wild-type OR13G1. Complementary approaches include molecular dynamics simulations to predict conformational changes upon mutation and photoaffinity labeling with reactive ligand analogs to directly identify interaction sites. For complex interaction networks, consider combinatorial mutagenesis of multiple residues simultaneously. Document all experimental conditions meticulously, including expression levels of each mutant, to ensure valid comparisons.

What are the recommended protocols for measuring OR13G1 membrane trafficking and surface expression?

Measuring OR13G1 membrane trafficking and surface expression requires a combination of biochemical and imaging techniques. For quantitative assessment of surface expression, use cell-surface biotinylation assays where extracellular proteins are labeled with membrane-impermeable biotin reagents, followed by streptavidin pull-down and Western blot analysis with OR13G1-specific antibodies. Flow cytometry offers another quantitative approach, particularly when OR13G1 is tagged with epitopes such as FLAG at the N-terminus, allowing detection with fluorescently labeled antibodies in non-permeabilized cells .

For visualization of trafficking dynamics, employ fluorescence microscopy with OR13G1 fused to fluorescent proteins or epitope tags. Confocal microscopy can determine colocalization with subcellular markers for the endoplasmic reticulum, Golgi apparatus, and plasma membrane. For higher resolution, super-resolution microscopy techniques such as STORM or PALM can reveal nanoscale organization at the cell surface.

To study trafficking kinetics, use pulse-chase experiments with photoactivatable or photoconvertible fluorescent protein fusions. Alternatively, employ fluorescence recovery after photobleaching (FRAP) to measure lateral mobility in the membrane. Pharmacological approaches, including treatment with trafficking modulators (e.g., brefeldin A, monensin), can provide insights into pathway dependencies. For in-depth analysis, combine these approaches with co-expression of known trafficking enhancers like RTP1S and analyze their effects on OR13G1 surface expression levels and functionality .

How can researchers effectively compare the functional properties of OR13G1 across different expression systems?

To effectively compare OR13G1 function across different expression systems, standardization of key variables is essential. Begin by ensuring consistent OR13G1 construct design across systems, including identical promoters, tags, and fusion partners where possible. Quantify expression levels in each system using techniques such as quantitative Western blotting or flow cytometry, and normalize functional data accordingly.

Develop a standardized functional readout applicable across systems, such as cAMP accumulation measured by ELISA or FRET-based sensors. Where direct comparisons are challenging, employ multiple, complementary assays in each system to build a comprehensive functional profile. For instance, combine luciferase reporter assays with calcium imaging and electrophysiology when possible .

Create standardized response metrics, such as fold-increase over baseline and EC50 values, rather than relying on raw signal intensities that vary between systems. Calibrate each system using reference odorants and receptors with well-established properties. Consider the expression of accessory proteins in each system, supplementing with co-transfection of factors like RTP1S and Gαolf where necessary .

Document detailed experimental conditions including cell density, transfection efficiency, temperature, and assay timings, as these can significantly impact receptor function. Finally, develop mathematical models that account for system-specific variables to facilitate more direct comparisons of intrinsic receptor properties across diverse experimental platforms.

How should researchers interpret conflicting results from different functional assays of OR13G1?

When faced with conflicting results from different functional assays of OR13G1, researchers should implement a systematic interpretative framework. Begin by critically evaluating each assay's biological relevance, sensitivity, and specificity. Consider whether assays measure different aspects of receptor function (e.g., ligand binding versus downstream signaling) that might legitimately yield different results. Examine the temporal resolution of each assay, as differences may reflect distinct phases of the receptor activation cycle.

Investigate assay-specific confounding factors, such as different receptor expression levels, cellular contexts, or off-target effects of test compounds. The cellular background can significantly impact receptor function, as seen in studies comparing olfactory receptor responses in HEK293 versus LNCaP cells . For instance, OR51T1 showed robust responses in LNCaP cells but not in HEK293 cells .

To resolve conflicts, perform additional validation experiments using orthogonal methods. Consider dose-dependent effects, as conflicting results might reflect different positions on the dose-response curve. Develop integrative models that incorporate data from multiple assays, weighted by reliability and relevance. When publishing, transparently report all results, including apparent conflicts, rather than selectively reporting confirmatory findings. Finally, consider biological variability as a legitimate explanation for differences, particularly when comparing in vitro systems to more complex in vivo environments.

How can OR13G1 research contribute to understanding olfactory coding mechanisms?

OR13G1 research provides a valuable model for understanding broader olfactory coding principles. By determining the specific ligand binding profile of OR13G1 through systematic screening and dose-response analyses , researchers can contribute to mapping the olfactory receptor repertoire and its relationship to odor perception. Comparative studies between OR13G1 and other olfactory receptors can reveal patterns in receptor tuning, from narrowly tuned specialists to broadly responsive generalists.

Structure-function studies of OR13G1, particularly through site-directed mutagenesis, can elucidate the molecular basis of odorant recognition and discrimination. This contributes to understanding how structural differences among hundreds of olfactory receptors enable discrimination of thousands of odorants . Investigating OR13G1 expression patterns in the olfactory epithelium can reveal organizational principles of the olfactory system, including zonal expression and the "one neuron-one receptor" rule.

Studying signal transduction pathways downstream of OR13G1 activation provides insights into olfactory information processing at the cellular level. Research on OR13G1 adaptation and sensitization mechanisms contributes to understanding temporal aspects of odor coding. Additionally, examining how OR13G1 contributes to mixture interactions when multiple odorants are present simultaneously addresses the complex challenge of mixture coding in olfaction. Finally, integrating OR13G1 findings with human psychophysical studies can help bridge molecular mechanisms with perceptual outcomes.

What approaches can be used to study OR13G1 in non-olfactory tissues?

Investigating OR13G1 in non-olfactory tissues requires specialized approaches that account for potentially different functions and expression levels compared to olfactory sensory neurons. Begin with comprehensive expression profiling using quantitative PCR, RNAseq, or single-cell sequencing technologies to identify tissues and specific cell types expressing OR13G1. For protein-level confirmation, develop and validate specific antibodies against OR13G1 or use epitope-tagged versions in model systems .

To determine functional roles, employ both gain- and loss-of-function approaches. CRISPR-Cas9 gene editing can generate tissue-specific OR13G1 knockouts, while lentiviral or adenoviral vectors can deliver OR13G1 for overexpression studies. For functional characterization, adapt the luciferase reporter assays used in olfactory research , but also explore tissue-specific readouts such as cell proliferation, migration, or specialized functions depending on the tissue context.

Consider using reporter gene fusions to monitor OR13G1 expression patterns in different tissues under various physiological or pathological conditions . Patient-derived cells or tissues can be valuable for studying OR13G1 in human disease contexts. Investigate potential endogenous ligands in non-olfactory tissues through metabolomic approaches and candidate testing, as these may differ from conventional odorants. Finally, employ tissue-specific conditional expression systems to study the temporal requirements of OR13G1 function during development or in adult physiology.

How might high-throughput screening methods be applied to identify novel ligands for OR13G1?

Applying high-throughput screening (HTS) methods to identify novel OR13G1 ligands requires sophisticated technical approaches and thoughtful experimental design. Develop stable cell lines expressing OR13G1 along with appropriate reporter systems, such as CRE-luciferase constructs that respond to cAMP signaling downstream of receptor activation . Optimize assay conditions for miniaturization to 384- or 1536-well format while maintaining robust signal-to-noise ratios. Implement automation for all steps including cell seeding, compound addition, and signal detection.

Design chemical libraries with diversity-oriented approaches that encompass both natural odorants and synthetic compounds. Consider structure-based virtual screening as a pre-filtering step if structural models of OR13G1 are available. Develop primary screening protocols that balance throughput with data quality, typically using single-concentration testing followed by confirmation and dose-response characterization of hits .

Implement data analysis pipelines that can handle large datasets and identify statistically significant hits while controlling for false discoveries. Counterscreening strategies should include testing hits against cells expressing no receptor or unrelated receptors to eliminate non-specific activators. Develop secondary assays using orthogonal detection methods such as calcium imaging or bioluminescence resonance energy transfer (BRET) to confirm true positives. Finally, cluster active compounds by chemical similarity to develop structure-activity relationships and potentially identify privileged scaffolds for OR13G1 ligands.

What emerging technologies could enhance structural understanding of OR13G1?

Emerging technologies are poised to revolutionize our structural understanding of OR13G1 and other olfactory receptors. Cryo-electron microscopy (cryo-EM) advancements now enable structural determination of GPCRs at near-atomic resolution, potentially allowing visualization of OR13G1 in different conformational states. Single-particle cryo-EM could be particularly valuable for capturing the receptor in complex with ligands or G proteins.

Integrative structural biology approaches combining multiple techniques (X-ray crystallography, NMR, cryo-EM, and computational modeling) can overcome limitations of individual methods. New protein engineering strategies, such as conformational stabilization through targeted disulfide bonds or fusion with stabilizing partners, may facilitate crystallization of OR13G1. Advanced computational methods, including AlphaFold2 and RoseTTAFold, can generate increasingly accurate models of OR13G1 structure, particularly when constrained by experimental data.

Single-molecule techniques such as FRET and fluorescence correlation spectroscopy (FCS) can provide insights into receptor dynamics and conformational changes upon ligand binding. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map ligand-induced conformational changes without requiring crystallization. Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) with purified receptor can provide direct measurement of binding kinetics and thermodynamics. Finally, native mass spectrometry approaches may reveal OR13G1 interaction partners and complex formation in near-native conditions, providing a more comprehensive understanding of receptor function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.