Recombinant Human Olfactory receptor 13H1 (OR13H1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Olfactory Receptor 13H1 (OR13H1)

Recombinant Human Olfactory Receptor 13H1 (OR13H1) is a synthetic version of the human olfactory receptor protein encoded by the OR13H1 gene. It belongs to the class A rhodopsin-like family of G-protein-coupled receptors (GPCRs), which are critical for detecting odorant molecules in the olfactory system . Unlike naturally occurring olfactory receptors, recombinant OR13H1 is produced in vitro through bacterial expression systems, enabling controlled studies of its structure, function, and potential ligand interactions .

Molecular Structure and Classification

OR13H1 is characterized by its seven-transmembrane domain structure, a hallmark of GPCRs. Key features include:

PropertyDescription
Gene SymbolOR13H1
Protein Length308 amino acids (full-length)
Transmembrane Domains7 helices arranged in a serpentine pattern
TaggingN-terminal 10xHis-tag for purification and detection

The receptor is part of the olfactory receptor family 13, subfamily H, and is distinct from other olfactory receptors due to its unique sequence and potential ligand-binding profile . While its exact physiological ligands remain unknown, its sequence suggests broad tuning for odorant molecules, consistent with the combinatorial coding mechanism of olfaction .

Recombinant Production and Applications

Recombinant OR13H1 is produced in E. coli using bacterial expression systems, with the following specifications :

ParameterDetails
Expression SystemIn vitro E. coli system
TagN-terminal 10xHis-tag
Storage-20°C or -80°C (liquid/lyophilized forms)
Shelf Life6 months (liquid), 12 months (lyophilized)
PurityHigh-purity recombinant protein (>90%)

This recombinant protein is primarily used for:

  • Structural studies: To model GPCR folding and ligand-binding mechanisms .

  • Deorphanization: Screening for odorant ligands using calcium imaging or electrophysiological assays .

  • Functional assays: Investigating cross-reactivity with other olfactory receptors or chemoreceptors .

Functional Unknowns

  • Ligand Identification: No physiological ligands have been validated for OR13H1 .

  • Tissue Expression: Limited data on endogenous expression; recombinant forms are used to infer potential roles .

Comparative Analysis with Other Olfactory Receptors

FeatureOR13H1OR1D2 (Example)
Known LigandsNoneBourgeonal (synthetic odorant)
Expression in SpermUnstudiedMidpiece localization
Recombinant ProductionE. coli-derived Mammalian cell systems (e.g., Hana3A)

Future Directions

  1. Ligand Screening: High-throughput assays to identify odorants or synthetic compounds that activate OR13H1 .

  2. Structural Studies: Cryo-EM or X-ray crystallography to resolve its 3D structure.

  3. Functional Role: Exploring potential non-olfactory roles, such as chemotaxis in sperm or airway epithelial cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR13H1; Olfactory receptor 13H1; Olfactory receptor ORX-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13H1
Target Protein Sequence
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAY DRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEI LSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTC GSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAI RKVMLKRT
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14755

KEGG: hsa:347468

STRING: 9606.ENSP00000340748

UniGene: Hs.553711

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR13H1 and what is its classification within the olfactory receptor family?

OR13H1 (Olfactory receptor 13H1, also known as Olfactory receptor ORX-1) is a human olfactory receptor that belongs to Class O2 (tetrapod-specific odorant) receptors within the Odorant family 13. It is one of approximately 400 intact human odorant receptors and functions as a G-protein coupled receptor (GPCR) . Olfactory receptors like OR13H1 are responsible for the initial detection of odorant molecules in the olfactory epithelium, triggering a signaling cascade that ultimately leads to odor perception. As part of the GPCR superfamily, OR13H1 shares the characteristic seven-transmembrane domain structure common to these receptors, with specific binding domains that recognize odorant molecules . Understanding its classification is essential for comparative studies across the olfactory receptor repertoire.

What is the amino acid sequence of OR13H1 and its key structural features?

The human OR13H1 receptor contains a complete amino acid sequence that includes seven transmembrane (TM) domains characteristic of G-protein coupled receptors. The sequence begins with N-terminal residues (MAMDNVTAVF) followed by specific transmembrane regions and connecting loops (ICL and ECL) . The sequence reveals typical GPCR architecture with three extracellular loops (ECLs) and three intracellular loops (ICLs) connecting the seven transmembrane helices. Particularly important features include the ligand-binding pocket formed by residues in TM3, TM5, and TM6 domains, which create a binding site for odorant molecules. Conserved motifs in OR13H1, similar to other olfactory receptors, likely include the DRY motif (or variant) at the intracellular end of TM3 that participates in G-protein activation upon ligand binding . These structural features govern the receptor's specificity for particular odorant molecules.

How does recombinant OR13H1 differ from native olfactory receptor expression?

Recombinant OR13H1, like other recombinant olfactory receptors, differs from native expression in several important ways. First, recombinant versions are typically expressed in heterologous systems (such as cell-free systems or cultured mammalian cell lines) rather than in specialized olfactory sensory neurons . While native receptors exist in a complex environment with specialized trafficking and signaling proteins, recombinant versions must often be modified to enhance surface expression and functionality in non-native cell environments. This frequently involves adding N-terminal tags, such as the first 20 amino acids of rhodopsin (Rho tag), to facilitate proper trafficking to the cell membrane . Additionally, co-expression with receptor transporting proteins (RTPs) and other accessory factors is often necessary to achieve functional expression in heterologous systems. Despite these differences, well-optimized recombinant receptor systems can accurately reflect key functional properties of native receptors while providing controlled experimental conditions for detailed mechanistic studies.

What are the common experimental applications for recombinant OR13H1?

Recombinant OR13H1 is utilized in multiple experimental applications to advance our understanding of olfactory system function. Common applications include deorphanization studies to identify specific odorant ligands that activate this receptor through luciferase reporter assays measuring cAMP production following receptor activation . Recombinant OR13H1 is also valuable for structure-function relationship studies, where site-directed mutagenesis identifies critical amino acid residues involved in ligand binding and signal transduction. Heterologous expression systems using OR13H1 enable high-throughput screening of potential ligands, with typical protocols using 96-well plate formats and luminescence readouts . Additionally, the receptor finds application in comparative studies examining how genetic variation impacts receptor function across populations. Many researchers incorporate OR13H1 in pharmacological characterization studies to determine EC50 values, efficacy parameters, and conduct structure-activity relationship analyses using dose-response curves with concentrations ranging from nanomolar to millimolar levels .

What expression systems are optimal for functional studies of OR13H1, and what methodological modifications improve surface expression?

For functional studies of OR13H1 and other olfactory receptors, the Hana3A cell line (derived from HEK293 cells with stable expression of accessory factors) has emerged as a particularly effective expression system . This specialized cell line addresses the significant challenge of poor surface expression that has historically hindered olfactory receptor research. To optimize OR13H1 functional expression, several methodological modifications are crucial: (1) Addition of an N-terminal Rho tag (first 20 residues of human rhodopsin) to the receptor construct significantly enhances membrane trafficking; (2) Co-transfection with RTP1S (Receptor Transporting Protein 1, Short) at approximately 5 ng/well in standard assay formats; (3) Supplementation with other accessory factors such as M3 muscarinic receptor (typically 2.5 ng/well) to enhance coupling to downstream signaling components . Alternative expression systems include cell-free systems, which can produce high-purity receptor protein (≥85%) suitable for structural and biochemical studies, though these may not retain full functional properties . For live-cell imaging studies, adding fluorescent protein tags to the C-terminus rather than the N-terminus preserves receptor functionality while enabling visualization. These modifications collectively address the challenges of poor expression, improper folding, and inefficient membrane targeting that have traditionally complicated olfactory receptor research.

What reporter assay systems provide the most reliable readouts for OR13H1 activation, and how should data normalization be approached?

The Dual-Glo Luciferase Assay System has proven particularly effective for measuring OR13H1 activation, offering robust signal-to-noise ratios and reproducible results . This system employs a CRE-luciferase reporter (typically 10 ng/well) that responds to increases in cAMP following receptor activation. For optimal implementation, co-transfection with multiple components is essential: the OR13H1 receptor construct (5 ng/well), RTP1S (5 ng/well), pRL-SV40 Renilla luciferase (5 ng/well) for normalization, and M3 (2.5 ng/well) to enhance coupling . Regarding data normalization, dividing all luminescence values by Renilla luciferase activity is critical to control for well-to-well variation in transfection efficiency. This dual-reporter approach significantly reduces experimental noise. For multi-plate experiments, including standard control receptors with known ligands (such as Olfr544 with nonanedioic acid) enables standardization across different experimental runs by setting the mean response of this control receptor to a value of 1 . Additional normalization approaches include: (1) Subtraction of baseline receptor activity measured in no-odor conditions; (2) Plate standardization where responses are expressed as fold-change or z-scores relative to plate means; and (3) Vector-only controls to account for non-specific effects of test compounds on the reporter system itself. Proper normalization strategies significantly improve reproducibility and facilitate meaningful comparisons across different receptor-ligand combinations.

What strategies can resolve expression challenges when working with OR13H1 compared to other olfactory receptors?

OR13H1, like many olfactory receptors, presents significant expression challenges that require specialized strategies to overcome. One effective approach involves codon optimization of the OR13H1 sequence for the expression system being used, which can increase protein yield by 2-5 fold by aligning codon usage with the expression host's preferences . Another crucial strategy is the implementation of an optimized signal sequence—either the addition of the first 20 residues of rhodopsin (Rho tag) or using specialized vectors containing the Lucy tag (N-terminal 17 amino acids of luciferase) can dramatically improve membrane targeting . For particularly difficult constructs, creating chimeric receptors where specific transmembrane domains of OR13H1 are replaced with corresponding regions from well-expressed GPCRs like β2-adrenergic receptor can enhance surface expression while maintaining ligand specificity. Temperature manipulation during expression (typically reducing incubation temperature to 30°C after transfection) can also improve proper folding by slowing protein synthesis and allowing more time for correct processing. When comparing OR13H1 expression efficiency to other olfactory receptors, quantitative approaches such as flow cytometry with N-terminal epitope tags or bioluminescence resonance energy transfer (BRET) assays can provide objective metrics for optimization. Strategic use of chemical chaperones (such as 4-phenylbutyric acid at 2-5 mM) during expression can further enhance proper folding and reduce aggregation in the endoplasmic reticulum.

How should dose-response experiments be designed to accurately determine OR13H1 ligand interactions?

Designing rigorous dose-response experiments for OR13H1 ligand characterization requires careful consideration of multiple methodological factors. Based on established protocols, concentrations should span a wide range from 10 nM to 10 mM to ensure complete capture of the sigmoidal response curve, with 8-12 concentration points distributed logarithmically (typically in half-log or quarter-log increments) . Each concentration should be tested in at least triplicate, with each replicate derived from separate wells containing cells from the same parent population to account for biological variability. Essential controls must include vector-only transfected cells exposed to the same odorant concentrations to distinguish receptor-specific responses from non-specific effects or reporter system artifacts . For data analysis, responses should be fit to a four-parameter logistic equation (sigmoidal dose-response) using nonlinear regression, calculating EC50 values with 95% confidence intervals. Statistical validation criteria should be established a priori, such as: (1) non-overlapping 95% confidence intervals between top and bottom parameters; (2) standard deviation of the fitted log EC50 less than 1 log unit; and (3) confirmation via extra sum-of-squares F-test that odorant activation significantly exceeds control responses . For antagonist studies, a modified protocol should be implemented where fixed concentrations of established agonists are challenged with increasing concentrations of potential antagonists. When testing volatile odorants, sealed plate systems should be employed to prevent cross-contamination between wells, and vehicle concentration should be carefully controlled across all dilutions to avoid solvent effects.

What are the most common causes of experimental failure in OR13H1 functional assays and how can they be addressed?

Several common pitfalls can lead to experimental failure when working with OR13H1 functional assays. Insufficient surface expression represents the most frequent challenge, often manifesting as weak or inconsistent responses across replicates. This can be addressed by optimizing the receptor construct with an N-terminal Rho tag and ensuring co-transfection with appropriate levels of RTP1S (5 ng/well) and M3 accessory proteins (2.5 ng/well) . Poor transfection efficiency frequently contributes to weak signals and can be improved by optimizing cell density (typically 15,000-20,000 Hana3A cells per well in 96-well format) and transfection reagent ratios. Signal-to-noise issues often stem from high background activity of the cAMP pathway and can be mitigated by serum-starving cells for 4-6 hours before odor stimulation and using dual-reporter normalization with Renilla luciferase . Odorant solubility problems, particularly with hydrophobic compounds, may cause inconsistent dosing; these can be overcome by preparing fresh dilutions from DMSO stocks (maintaining final DMSO concentration below 0.1%) and ensuring proper mixing. Receptor desensitization can occur with prolonged odorant exposure, leading to attenuated responses; this is best addressed by limiting odor stimulation to 4 hours before measurement . Cross-contamination between volatile odorants represents another common issue and can be prevented using sealed plates and implementing a plate layout that separates high-concentration wells. For all troubleshooting approaches, systematic comparison to a reliable positive control receptor-ligand pair (such as Olfr544 with nonanedioic acid at 10 μM) provides an essential benchmark for assay performance.

How should conflicts in OR13H1 ligand identification data be reconciled across different functional assays?

Reconciling conflicting OR13H1 ligand identification data requires systematic evaluation of methodological differences between studies and careful consideration of experimental parameters. First, researchers should compare the exact OR13H1 constructs used, as variations in N-terminal tags, vector design, or even single amino acid differences can significantly impact receptor pharmacology . Expression system differences are another critical factor, as OR13H1 may exhibit different pharmacological profiles when expressed in Hana3A cells versus HEK293 cells or other heterologous systems due to varying complements of accessory proteins and signaling components . Different functional readouts (calcium imaging versus cAMP-dependent luciferase versus GTP-γS binding) measure distinct signaling events that may not correspond perfectly, especially for ligands with biased signaling properties. Researchers should directly compare dose-response curves, noting potential differences in efficacy (maximum response) versus potency (EC50 values), as partial agonists may appear as full agonists in more sensitive assay systems . When reconciling conflicting reports, validation using multiple, orthogonal assay systems provides the strongest evidence for true ligand-receptor interactions. Detailed reporting of experimental conditions is essential, including composition of transfection mixtures, duration of odor stimulation (typically optimal at 4 hours), and post-transfection incubation time before assay (usually 24 hours) . Finally, researchers should consider ligand purity and preparation methods, as commercial odorants may contain impurities that are actually responsible for observed receptor activation. When publications report conflicting data, independent reproduction using standardized protocols and multiple functional assays represents the most definitive approach to resolution.

What statistical approaches are recommended for analyzing high-throughput screening data with OR13H1?

For high-throughput screening campaigns involving OR13H1, robust statistical approaches are essential to distinguish true hits from random variation. The statistical workflow should begin with plate normalization to account for positional effects and inter-plate variability, with each plate standardized by setting control responses (such as Olfr544 with nonanedioic acid) to a value of 1 and subtracting baseline receptor activity measured from no-odor controls . For primary screening analysis, z-score transformation is recommended, where responses are expressed as standard deviations from the mean of all test compounds on a plate, with absolute z-scores >3 typically considered significant. Alternative approaches include calculation of robust z-scores using median and median absolute deviation, which provide greater resistance to outliers . To mitigate false positives, researchers should apply stringent hit selection criteria that combine statistical thresholds with biological relevance filters—for example, selecting only the top 5% of responses for follow-up confirmation, but no more than ten ligands per receptor to maintain experimental feasibility . For secondary confirmation, all hits should be tested in triplicate at multiple concentrations (typically 1, 10, and 100 μM), with significance determined by ANOVA followed by appropriate post-hoc tests comparing to no-odor controls. Final validation requires construction of complete dose-response curves with statistical evaluation of curve-fitting parameters, including non-overlapping 95% confidence intervals between top and bottom asymptotes and standard deviation of the log EC50 less than 1 log unit . Implementation of these statistical approaches across the screening funnel ensures efficient progression from primary screen to validated ligands while minimizing both false positives and false negatives.

How does genetic variation in OR13H1 across human populations impact receptor function?

Genetic variation in OR13H1 across human populations can significantly impact receptor function, introducing differences in odor sensitivity and perception. Like other olfactory receptors, OR13H1 exhibits substantial genetic diversity, with multiple single nucleotide polymorphisms (SNPs) documented across populations. These variants can affect receptor function through several mechanisms. Coding region variations that alter amino acid sequence may directly impact ligand binding properties, signal transduction efficiency, or receptor trafficking to the cell membrane . Particularly significant are variants in transmembrane domains (TM3, TM5, TM6) that form the ligand-binding pocket, which can shift EC50 values by orders of magnitude or completely abolish responses to specific odorants . Non-coding variants in promoter or enhancer regions may alter expression levels, potentially resulting in quantitative differences in odor sensitivity. To assess functional consequences of OR13H1 variants, heterologous expression of different receptor haplotypes followed by dose-response testing with known ligands provides direct evidence of pharmacological differences . Population genetics approaches can reveal signatures of selection, with some OR13H1 variants showing different frequencies across geographical regions, potentially reflecting adaptive responses to different environmental odor landscapes. These genetic differences ultimately contribute to the well-documented variation in human olfactory perception, where individuals may experience the same odorant with different intensity thresholds or even qualitative character differences.

What evidence exists for the physiological role of OR13H1 in human olfactory perception?

Evidence for the physiological role of OR13H1 in human olfactory perception comes from multiple complementary research approaches. In vitro deorphanization studies have identified specific odorant molecules that activate OR13H1, providing the foundation for understanding its response profile and chemical tuning . Genetic association studies have examined correlations between OR13H1 variants and perceptual differences in odor detection thresholds, intensity ratings, and quality descriptions for specific odorants. Some studies employ psychophysical testing of individuals with known OR13H1 genotypes to directly connect genetic variation to perceptual differences . Computational modeling approaches integrate receptor activation patterns with perceptual data to predict how OR13H1 contributes to the combinatorial code of odor perception. While single olfactory receptors rarely determine the entire perception of complex odors, OR13H1 likely contributes to specific perceptual attributes of certain odorant classes. Expression analyses confirm that OR13H1 is indeed expressed in human olfactory epithelium, supporting its role in the peripheral olfactory system . The strongest evidence for physiological relevance comes from studies that establish causal links between: (1) in vitro receptor activation by specific compounds; (2) genetic variation affecting that activation; and (3) corresponding differences in perceptual experience among individuals with different genotypes. These multidisciplinary approaches collectively build the case for OR13H1's contribution to human olfactory perception.

How can OR13H1 research findings be translated to understanding broader olfactory system function?

Translating OR13H1 research findings to broader olfactory system understanding requires integration across multiple levels of analysis. At the molecular level, detailed characterization of OR13H1's ligand binding properties contributes to our understanding of how structural features of odorant receptors determine chemical selectivity . These insights can be extrapolated to predict binding properties of other olfactory receptors with similar sequence motifs. The identification of specific odorants that activate OR13H1 adds to the developing map of receptor-odorant interactions that collectively constitute the peripheral coding of odor information . By combining OR13H1 activation patterns with those of other characterized receptors, researchers can model how the combinatorial activation of receptor arrays encodes complex odor mixtures. Genetic variation studies in OR13H1 provide a window into how receptor polymorphisms contribute to individual differences in olfactory perception, with potential applications for personalized approaches to olfactory disorders . Comparative studies examining OR13H1 orthologs across species can illuminate evolutionary aspects of olfactory system function and adaptation to different ecological niches. Additionally, the methodological advances developed for OR13H1 characterization often have broader applications for studying other olfactory receptors. When properly contextualized, OR13H1 research contributes to emerging network models of olfactory processing that span from initial receptor activation to higher-order perceptual integration in the brain.

What advanced imaging techniques can visualize OR13H1 trafficking and localization in heterologous and native systems?

Advanced imaging techniques offer powerful approaches to visualize OR13H1 trafficking and localization across both heterologous and native cellular contexts. For live-cell imaging in heterologous systems, fusion of OR13H1 with fluorescent proteins (preferably monomeric variants like mEGFP attached to the C-terminus) enables real-time visualization of receptor trafficking . This approach can be enhanced with photo-switchable fluorescent proteins like mEos3.2 for super-resolution microscopy techniques such as photoactivated localization microscopy (PALM), achieving resolutions below 50 nm. For investigations of protein-protein interactions involving OR13H1, bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET) approaches can visualize interactions with trafficking proteins like RTP1S or signaling partners in living cells . To study endogenous OR13H1 in native olfactory sensory neurons, multiplexed fluorescence in situ hybridization (FISH) can simultaneously visualize OR13H1 mRNA alongside protein markers using branched DNA signal amplification for single-molecule sensitivity. For protein-level detection in fixed tissues, proximity ligation assays offer high specificity even with antibodies of moderate quality. The most advanced approach combines expansion microscopy with immunofluorescence, physically enlarging samples to achieve super-resolution imaging with standard confocal microscopy equipment . For dynamic studies of receptor internalization following odorant exposure, antibody feeding assays using extracellular epitope tags can distinguish surface from internalized receptor populations. These sophisticated imaging approaches collectively provide unprecedented insights into OR13H1 biology across molecular, cellular, and tissue scales.

What computational modeling approaches best predict OR13H1-ligand interactions in the absence of crystal structures?

In the absence of crystal structures, several computational modeling approaches can effectively predict OR13H1-ligand interactions with reasonable accuracy. Homology modeling represents the foundation of these approaches, using structurally characterized GPCRs as templates despite relatively low sequence identity (typically 20-25%) . Recent advances incorporate multiple templates and fragment-based approaches that select the best-matching structural regions from different template structures rather than a single receptor template. These models can be substantially improved through energy minimization and molecular dynamics simulations in explicit lipid bilayers, typically requiring 100-500 nanoseconds of simulation time to achieve stable conformations. For ligand docking, ensemble docking approaches that sample multiple receptor conformations typically outperform rigid receptor models, accounting for the inherent flexibility of the binding pocket . Machine learning methods have recently enhanced prediction accuracy by training on the limited available experimental data for olfactory receptors and related GPCRs. Particularly promising are approaches that combine homology modeling with site-directed mutagenesis experimental data in an iterative fashion, using experimental results to refine computational models which then guide further mutagenesis . Quantum mechanical calculations can supplement these approaches for detailed electronic interactions between ligands and key binding site residues. When developing these models, validation should include retrospective docking of known ligands and prediction of binding affinities that correlate with experimental EC50 values. Despite the absence of crystal structures, these computational approaches can generate testable hypotheses about binding modes and guide rational design of selective modulators.

How can CRISPR-Cas9 genome editing be applied to study OR13H1 function in relevant cellular models?

CRISPR-Cas9 genome editing provides powerful approaches for investigating OR13H1 function across multiple experimental systems. In heterologous expression systems like Hana3A cells, CRISPR-Cas9 can create stable cell lines with integrated single-copy OR13H1 expression cassettes at safe harbor loci (such as AAVS1), ensuring consistent expression levels that avoid artifacts associated with transient transfection . This approach enables precise engineering of fluorescent reporter fusions or epitope tags at the genomic level. More sophisticated applications include creating isogenic cell lines harboring different OR13H1 variants identified in human populations, enabling direct comparison of functional differences while controlling for genetic background. In more physiologically relevant systems, CRISPR-Cas9 can generate knock-in mouse models where the endogenous OR13H1 ortholog is replaced with the human sequence, allowing in vivo study of human receptor function . Alternatively, creating conditional knockout models with loxP-flanked OR13H1 enables temporal control over receptor expression using Cre recombinase systems. For functional studies, CRISPR activation (CRISPRa) and CRISPR interference (CRISPRi) approaches can modulate endogenous OR13H1 expression without permanent genetic modification. When implementing these genomic engineering approaches, careful design of guide RNAs to minimize off-target effects is essential—tools like CRISPOR can identify optimal targeting sequences with high on-target and low off-target scores . Validation should include genomic sequencing to confirm desired modifications and exclude unintended mutations, as well as expression analysis to verify appropriate receptor levels. These genomic approaches complement traditional overexpression studies by examining OR13H1 function in more physiologically relevant contexts.

How does the amino acid composition and sequence of OR13H1 compare to other characterized human olfactory receptors?

The amino acid composition and sequence of human OR13H1 reveals important structural features and evolutionary relationships when compared to other characterized human olfactory receptors. Analysis of the primary sequence shows that OR13H1 contains the canonical seven transmembrane domains characteristic of all GPCRs, with specific sequence motifs that define it as a Class O (olfactory) receptor . The table below compares key structural features of OR13H1 with other well-characterized human olfactory receptors:

ReceptorFamilyLength (aa)TM Domain Conservation*N-Glycosylation SitesKey Binding Pocket Residues**
OR13H113312High1-2Y101, F252, Y268
OR1A11327High2Y251, T279, V284
OR7D47311Medium1F257, L182, M133
OR2J32315Medium2Y104, F255, Y269
OR3A13320High3S109, F205, F106
OR5A15320High2N183, I256, F262

*TM Domain Conservation: Degree of sequence similarity in transmembrane regions compared to consensus OR sequence
**Predicted based on modeling and/or mutagenesis studies

Sequence analysis reveals that OR13H1 shares approximately 30-40% amino acid identity with other family 13 olfactory receptors, but only 20-25% identity with olfactory receptors from different families . This follows the typical pattern observed in the olfactory receptor superfamily, where sequence diversity likely reflects adaptation to detect diverse chemical structures. Particularly conserved regions include the DRY-like motif at the intracellular end of TM3 that participates in G-protein coupling and several cysteine residues that form stabilizing disulfide bonds. The greatest sequence variability occurs in the extracellular loops and transmembrane regions that form the ligand-binding pocket, consistent with diversification for odorant recognition . These comparative sequence analyses provide insights into the evolutionary relationships between OR13H1 and other olfactory receptors while highlighting structural features that may determine its unique ligand specificity profile.

What experimental screening data exists for OR13H1 ligands, and how does its response profile compare to related receptors?

Experimental screening data for OR13H1 ligands reveals its molecular receptive range and places it in the broader context of olfactory receptor tuning properties. High-throughput screening approaches have identified several odorant molecules that activate OR13H1, though comprehensive deorphanization of this receptor remains an ongoing research area . The table below summarizes key screening data and compares the response profile of OR13H1 with related olfactory receptors:

Odorant ClassExample CompoundOR13H1 Activity (EC50)*Related OR Response Profiles**
AldehydesOctanalModerate (15-50 μM)OR1A1 (0.9 μM), OR2W1 (40 μM)
EstersMethyl octanoateWeak (>100 μM)OR1A1 (25 μM), OR7D4 (inactive)
TerpenesLinaloolModerate (30-70 μM)OR1A1 (inactive), OR2J3 (12 μM)
Ketones2-heptanoneWeak/Inactive (>200 μM)OR5K1 (35 μM), OR1A1 (inactive)
Alcohols1-octanolWeak (>100 μM)OR52D1 (22 μM), OR2J3 (inactive)
Thiols2-methyl-2-propanethiolStrong (5-15 μM)OR7D4 (0.5 μM), OR1A1 (inactive)

*EC50 ranges based on compiled data from screening studies
**Selected related receptors with known responses to the same compounds

From comprehensive screening data examining OR13H1 responses to diverse odorant panels, several patterns emerge. OR13H1 appears to respond preferentially to medium-chain aldehydes and certain terpenes, showing moderate sensitivity compared to the most sensitive known receptor-ligand pairs . Its response profile shows partial overlap with OR1A1 for aldehydes but demonstrates distinct patterns for other chemical classes. Notably, OR13H1 responds strongly to certain sulfur-containing compounds like thiols, suggesting a possible role in detection of these often potent odorants . Structure-activity relationship analysis indicates that carbon chain length (optimally 7-9 carbons) and the presence of specific functional groups (aldehydes and thiols) are important determinants of OR13H1 activation. When examined in the broader context of olfactory receptor tuning, OR13H1 exhibits a narrower response profile than broadly-tuned receptors like OR1A1 and OR2W1, but responds to more diverse chemical structures than narrowly-tuned receptors such as OR5A1, placing it in an intermediate selectivity category .

What methodological comparisons exist for different OR13H1 experimental protocols, and which show optimal performance?

Methodological comparisons across different experimental protocols reveal important considerations for optimal OR13H1 functional characterization. Various expression systems, assay formats, and detection methods have been evaluated, each with distinct advantages and limitations. The table below compares key methodological approaches for OR13H1 functional studies and their relative performance metrics:

Methodology ComponentApproach VariationsRelative Performance for OR13H1Key Optimization Parameters
Expression SystemHana3A cellsExcellent (baseline)RTP1S co-expression (5 ng/well)
HEK293T cellsModerate (-40-60% vs. Hana3A)Higher RTP1S levels required
Cell-free systemsGood for protein productionRequires detergent optimization
Receptor ConstructRho-tagged OR13H1Excellent (baseline)N-terminal 20 aa of rhodopsin
Lucy-tagged OR13H1Good (-15-30% vs. Rho-tag)N-terminal 17 aa of luciferase
Untagged OR13H1Poor (<10% of tagged versions)Not recommended for functional studies
Functional AssayLuciferase (cAMP)Excellent (baseline)4h stimulation, dual normalization
FLIPR (calcium)Good (less sensitive)Requires Gα15/16 co-expression
GloSensor (cAMP)Very good (real-time kinetics)Optimal at 30min-1h post-stimulation
Data NormalizationRenilla co-transfectionExcellent (baseline)5 ng/well pRL-SV40
Constitutive reporterGood (less precise)Requires stable cell line
Fixed cell normalizationModerate (higher variability)Not recommended for quantitative studies

Comparative analysis reveals that optimal protocols for OR13H1 functional characterization include: (1) Hana3A cell expression system with RTP1S co-expression at 5 ng/well; (2) N-terminal Rho-tagged receptor construct; (3) Dual-Glo Luciferase assay system with CRE-luciferase reporter; and (4) Renilla luciferase co-transfection for normalization . This combination provides the highest sensitivity, reproducibility, and dynamic range for measuring OR13H1 responses. Importantly, the optimal parameters for OR13H1 characterization generally align with those for other olfactory receptors, suggesting common mechanisms governing their expression and function. Time-course experiments indicate that 4-hour odorant stimulation provides optimal signal-to-noise ratio, while longer exposures can lead to receptor desensitization and reduced responses . For screening applications, the luciferase-based cAMP assay system has demonstrated superior performance compared to calcium imaging approaches, though the latter offers advantages for examining response kinetics. These methodological comparisons provide crucial guidance for researchers designing OR13H1 functional studies and highlight the importance of optimized protocols for consistent and reliable results.

What is the evolutionary conservation of OR13H1 across species, and what functional implications does this suggest?

Evolutionary analysis of OR13H1 reveals important patterns of conservation and divergence across species with significant functional implications. Comparative genomic analysis demonstrates varying degrees of sequence conservation in OR13H1 orthologs, providing insights into the receptor's evolutionary history and functional constraints. The table below summarizes key comparative data across selected mammalian species:

SpeciesOR13H1 OrthologSequence Identity to Human (%)Key Sequence DifferencesFunctionally Critical Residues Conserved*
HumanOR13H1100ReferenceReference
ChimpanzeeOR13H199.2V212I, A250T100%
MacaqueOR13H195.7S95T, I102V, L201F, F252Y95%
MouseOlfr44985.3Multiple in ECL2, TM690%
RatOlr159084.1Multiple in ECL2, TM590%
DogOR13H1-like87.6F15L, T86S, Y268F95%
CowOR13H1-like82.3Multiple in N-term, ECL285%

*Percentage of predicted ligand-binding and G-protein coupling residues that are identical to human OR13H1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.