Recombinant Human Olfactory receptor 13J1 (OR13J1)

Shipped with Ice Packs
In Stock

Description

General Overview of Olfactory Receptors

Olfactory receptors (ORs) constitute a large family of G-protein-coupled receptors (GPCRs) that play a fundamental role in detecting odorant molecules present in the surrounding environment. These receptors interact with odorant molecules in the nose to initiate neuronal responses that trigger the perception of smell . The olfactory receptor family represents the largest gene family in the human genome, with members arising from single coding-exon genes . These receptors share a characteristic seven-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G-protein-mediated transduction of odorant signals . This extensive receptor family enables humans to detect and discriminate between thousands of different odors through a combinatorial coding mechanism.

Functional studies have revealed that the OR family includes members capable of responding to a broad range of odorants, while others are activated by only a limited number of structurally related odorant molecules . This diversity in ligand specificity contributes to the remarkable discriminatory power of the human olfactory system, allowing for the perception of complex odor landscapes with high precision and sensitivity.

Molecular Characterization of OR13J1

Olfactory Receptor 13J1, also known as OR13J1 or OR9-2, is a specific member of the olfactory receptor family encoded by the OR13J1 gene in humans . Like other olfactory receptors, OR13J1 functions as a GPCR involved in the detection of specific odorant molecules and the subsequent transduction of signals to the brain . The full-length human OR13J1 protein consists of 312 amino acids with a calculated molecular weight of approximately 34.7 kDa . As a class A GPCR, OR13J1 exhibits the characteristic structural features of this receptor superfamily, particularly the seven-transmembrane domain arrangement that creates a binding pocket for odorant molecules.

The nomenclature assigned to OR13J1, like other olfactory receptors in humans, follows a systematic classification scheme based on sequence similarity and phylogenetic relationships . This standardized naming system facilitates comparative studies across different olfactory receptors and between species, contributing to our understanding of the evolution and functional diversity of these sensory proteins.

Genetic Information and Expression

The human OR13J1 gene is identified by several database entries, including UniProt primary accession number Q8NGT2 and alternative UniProt secondary accession numbers B2RN66, Q6IF20, and Q96R40 . The gene is also referenced in various biological databases such as KEGG (hsa:392309) and String (9606.ENSP00000367219) . The OR13J1 gene, like other olfactory receptor genes, arises from a single coding exon, distinguishing it from many other genes that contain multiple exons separated by introns .

Protein Structure and Domains

OR13J1 exhibits the characteristic structural features of class A GPCRs, with seven alpha-helical transmembrane domains connected by alternating intracellular and extracellular loops . This structural arrangement creates a binding pocket that accommodates odorant molecules, initiating the signaling cascade that leads to odor perception. The transmembrane domains are anchored in the cell membrane, with the N-terminus positioned extracellularly and the C-terminus extending into the cytoplasm.

The extracellular domains of OR13J1, particularly the N-terminus and the extracellular loops, contribute to ligand recognition and binding specificity. The intracellular regions, especially the third intracellular loop and the C-terminal tail, are involved in G-protein coupling and downstream signal transduction. This structural organization enables OR13J1 to function as a molecular transducer, converting the chemical information of odorant binding into cellular signals that ultimately lead to odor perception.

Post-translational Modifications

While the provided search results do not specifically detail the post-translational modifications of OR13J1, olfactory receptors typically undergo several modifications that influence their localization, stability, and function. These may include N-linked glycosylation at specific asparagine residues in the extracellular domains, which can affect protein folding and cell surface expression. Phosphorylation of serine and threonine residues in the intracellular regions, particularly in the C-terminal tail, may regulate receptor desensitization and internalization following activation.

Understanding the post-translational modifications of OR13J1 represents an important aspect of characterizing this receptor's functional properties and regulatory mechanisms. Future studies focusing on these modifications could provide insights into the factors that influence OR13J1's sensitivity, specificity, and signaling dynamics in the olfactory system.

Expression Systems and Methodologies

The production of recombinant OR13J1 has been achieved using various expression systems, each with specific advantages and limitations. Bacterial expression in E. coli has been successfully employed to generate full-length human OR13J1 protein fused to an N-terminal His tag . This approach offers advantages in terms of high yield, cost-effectiveness, and scalability, making it suitable for applications requiring substantial amounts of protein.

Alternative expression systems include yeast-based platforms, which have been used to produce partial recombinant human OR13J1 . The eukaryotic cellular environment of yeast may provide advantages for proper folding and post-translational modifications of the receptor, potentially enhancing its structural integrity and functional properties.

Studies on other olfactory receptors have utilized mammalian cell lines, such as HEK293S cells, for recombinant expression . These systems more closely mimic the natural cellular context of olfactory receptors and may be particularly valuable for functional studies, as they provide the appropriate machinery for G-protein coupling and downstream signaling.

Purification Techniques and Quality Assessment

Purification of recombinant OR13J1 typically involves chromatographic techniques to achieve high purity. For His-tagged OR13J1, immobilized metal affinity chromatography (IMAC) can be employed as an initial purification step, taking advantage of the specific interaction between the His tag and metal ions such as nickel or cobalt . This approach allows for selective enrichment of the target protein from the complex mixture of cellular components.

Further purification may involve additional chromatographic steps, such as size exclusion chromatography (gel filtration), which separates proteins based on their molecular size and can distinguish between monomeric and oligomeric forms of the receptor . This multi-step purification process can yield protein preparations with purity exceeding 90% as determined by SDS-PAGE analysis .

Quality assessment of purified recombinant OR13J1 involves various analytical techniques to confirm its identity, purity, and structural integrity. These include SDS-PAGE for purity evaluation, mass spectrometry for molecular weight confirmation, and circular dichroism spectroscopy for assessment of secondary structure and proper folding . Functional assays, such as ligand binding studies, can verify that the purified receptor retains its biological activity.

Signal Transduction Mechanisms

OR13J1, like other olfactory receptors, functions as a molecular transducer that converts chemical signals (odorant binding) into electrical signals in olfactory sensory neurons. This signal transduction process begins when an odorant molecule binds to the receptor, inducing a conformational change that activates the associated G-protein, typically Golf (a specialized G-protein found in olfactory neurons) .

The activated G-protein stimulates adenylyl cyclase, leading to increased production of cyclic AMP (cAMP) within the cell . Elevated cAMP levels trigger the opening of cyclic nucleotide-gated ion channels in the cell membrane, resulting in an influx of calcium and sodium ions. This ion flux causes membrane depolarization, generating an action potential that is transmitted along the axon of the olfactory sensory neuron to the olfactory bulb in the brain, where it is processed as a specific odor perception.

Research on olfactory receptors has employed real-time cAMP assays to analyze their functional activity in heterologous expression systems . Similar methodologies could be applied to study OR13J1's signaling properties, providing insights into its activation kinetics and signal amplification characteristics.

Ligand Binding and Specificity

Studies on other human olfactory receptors have demonstrated ligand binding with affinities in the micromolar range . For example, research on the human olfactory receptor hOR1A1 showed that it bound its cognate odorant, dihydrojasmone, with micromolar affinity . Similar binding characteristics might be expected for OR13J1, though specific studies focusing on this receptor would be necessary to determine its particular ligand preferences and binding affinities.

The development of intrinsic tryptophan fluorescence assays and other biophysical techniques for quantifying ligand binding to detergent-solubilized olfactory receptors offers promising approaches for investigating the ligand binding properties of OR13J1 in future research.

Antibodies and Immunological Detection

Antibodies against OR13J1 provide valuable tools for detecting and studying this receptor in various experimental contexts. A commercially available polyclonal antibody raised in rabbits against a synthetic peptide corresponding to amino acids 244-272 from the C-terminal region of human OR13J1 has been developed for research applications . This antibody has been tested for several experimental techniques, including enzyme-linked immunosorbent assay (ELISA), Western blotting (WB), and immunohistochemistry on paraffin-embedded tissues (IHC-P) .

The recommended dilutions for these applications are 1/1000 for Western blotting and 1/50-1/100 for immunohistochemistry . The antibody is provided in liquid form in PBS containing 0.09% sodium azide as a preservative, with storage at -20°C recommended to maintain its activity . This immunological tool enables researchers to investigate the expression, localization, and potential interactions of OR13J1 in various biological samples.

Gene Expression Analysis

Analysis of OR13J1 gene expression in different tissues and developmental stages provides insights into its biological roles and regulatory mechanisms. While the provided search results include limited information on OR13J1 gene expression studies, databases such as the Mouse Genome Informatics (MGI) resource contain expression data for the mouse ortholog of OR13J1 , which may offer comparative information relevant to understanding the human receptor.

Modern gene expression analysis techniques, including quantitative PCR, RNA sequencing, and in situ hybridization, can be applied to investigate OR13J1 expression patterns in various tissues and experimental conditions. These approaches enable researchers to determine the spatial and temporal dynamics of OR13J1 expression, potentially revealing novel functions beyond its established role in olfactory perception.

Functional Assays

Functional characterization of OR13J1 requires assays that can detect and quantify its activation in response to odorant stimulation. While specific functional assays for OR13J1 are not detailed in the provided search results, studies on other olfactory receptors have utilized several approaches that could be adapted for OR13J1 research.

Real-time cAMP assays have been employed to analyze the functional activity of olfactory receptors in heterologous expression systems . These assays detect changes in intracellular cAMP levels following receptor activation, providing a readout of signaling activity. Calcium imaging represents another valuable approach, as olfactory receptor activation leads to calcium influx in olfactory sensory neurons.

Intrinsic tryptophan fluorescence assays have been used to quantify ligand binding to detergent-solubilized olfactory receptors . This biophysical technique detects changes in the fluorescence properties of tryptophan residues within the receptor upon ligand binding, providing information about binding affinity and kinetics.

These functional assays, combined with structural and expression studies, offer complementary approaches for investigating the biological properties of OR13J1 and its role in olfactory perception.

Olfactory Coding and Perception

OR13J1 represents one component of the complex combinatorial coding system that enables humans to detect and discriminate between thousands of different odors. Characterizing the ligand binding profile of OR13J1 would enhance our understanding of its specific contribution to this coding mechanism, revealing the odorant molecules or structural features that it recognizes.

Studies on other olfactory receptors have shown that each odorant typically activates multiple receptors, and each receptor can respond to multiple odorants with varying affinities . This creates a unique activation pattern for each odor, which the brain interprets as a specific smell perception. Determining OR13J1's position within this coding framework would provide insights into its role in the perception of particular odors or odor categories.

Therapeutic and Biotechnological Applications

Beyond their role in olfaction, olfactory receptors have been implicated in various physiological and pathological processes outside the olfactory system. While specific non-olfactory functions of OR13J1 have not been established in the provided search results, the emerging understanding of ectopic olfactory receptor expression suggests potential roles in diverse biological contexts.

If OR13J1 is found to be expressed in specific tissues or associated with particular pathological conditions, it could serve as a biomarker for diagnostic purposes or a target for therapeutic interventions. The development of modulators (agonists or antagonists) targeting OR13J1 could have applications in areas such as aromatherapy, flavor enhancement, or odor masking, as well as potential therapeutic uses if OR13J1 is implicated in disease processes.

Furthermore, the utilization of OR13J1 and other olfactory receptors in biosensor technologies represents an innovative application that harnesses their high sensitivity and specificity for odorant detection. These "bioelectronic noses" could provide portable, cost-effective systems for applications ranging from food quality assessment to environmental monitoring and medical diagnostics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR13J1; Olfactory receptor 13J1; Olfactory receptor OR9-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR13J1
Target Protein Sequence
MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAY DRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCK ILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFST CLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAMVTTMLNPTIYSLRNKEVKEA ARKVWGRSRASR
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15108

KEGG: hsa:392309

STRING: 9606.ENSP00000367219

UniGene: Hs.527480

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Structural and Classification Information

What is OR13J1 and how is it classified within the olfactory receptor family?

Human Olfactory Receptor 13J1 (OR13J1) belongs to the extensive family of olfactory receptors, which are classified as G-protein coupled receptors (GPCRs) . These receptors function as molecular conduits for transmitting chemical signals, orchestrating transitions between active and inactive states upon ligand binding, thereby bridging the extracellular and intracellular domains . OR13J1, like other olfactory receptors, likely possesses the characteristic seven-transmembrane domain structure typical of GPCRs, with specific binding pockets that can interact with odorant molecules. The receptor is encoded by the gene symbol OR13J1, with the KEGG identifier hsa:392309, indicating its position within the human genome annotation . Unlike some other olfactory receptors that have been extensively characterized, OR13J1 remains relatively understudied, with limited published information regarding its specific structure-function relationships.

What structural characteristics are predicted for OR13J1, and how do they compare to characterized olfactory receptors?

While the precise three-dimensional structure of OR13J1 has not been experimentally determined, advances in computational biology tools like AlphaFold offer promising avenues for structural prediction . Similar to the structurally characterized OR51E2, OR13J1 likely contains a compact binding pocket capable of forming both polar interactions (hydrogen and ionic bonds) and non-specific hydrophobic interactions with potential ligands . The structural arrangement of OR13J1 would presumably differ from insect odorant-gated ion channels, suggesting a unique selectivity profile . Recent breakthroughs in human olfactory receptor structural biology, such as the elucidation of OR51E2's structure in 2023, provide valuable templates and methodological frameworks that could be applied to predict OR13J1's structural features . Researchers should note that AlphaFold predictions may be limited to a single conformational state (either active or inactive), necessitating complementary approaches like molecular dynamics simulations to explore the receptor's full conformational landscape .

Detection and Quantification Methods

What methods are available for detecting and quantifying OR13J1 in laboratory settings?

Enzyme-Linked Immunosorbent Assay (ELISA) represents a primary method for detecting and quantifying OR13J1 in research settings . Commercial ELISA kits for OR13J1 typically offer a quantitative colorimetric detection method with a test range of 0.156 ng/ml to 10 ng/ml, suitable for analyzing tissue homogenates, cell lysates, and other biological fluids . For optimal results with ELISA, sample concentrations should be diluted to the mid-range of the kit to ensure accuracy within the standard curve . Alternative detection methods might include Western blotting, immunohistochemistry, or mass spectrometry-based proteomics, though these approaches would require validation with appropriate antibodies or peptide standards specific to OR13J1. RNA-based detection methods such as quantitative PCR could also be employed to assess OR13J1 expression at the transcriptional level, particularly when protein detection proves challenging.

What considerations should researchers take into account when working with OR13J1 detection assays?

Researchers should be aware that many commercial kits for OR13J1 detection are optimized for native protein rather than recombinant forms, which may have different sequences or tertiary structures . This distinction is crucial when designing experiments, as detection efficacy could vary significantly between native and recombinant proteins. The stability of detection reagents, particularly antibodies used in immunoassays, should be carefully monitored, with attention to storage conditions and expiration dates . For ELISA-based detection, the loss rate should be less than 5% within the expiration date under appropriate storage conditions . To minimize performance fluctuations, researchers should standardize laboratory conditions and procedures, ideally having the same user perform the entire assay . Additionally, proper validation controls should be included, and researchers must determine optimal dilutions or concentrations based on their specific experimental conditions and sample types .

Genetic and Proteomic Data

What are the key genetic and proteomic identifiers for OR13J1?

OR13J1 is identified by several standardized database entries that provide essential reference points for researchers. The gene is designated by the symbol OR13J1, while the protein's UniProt Primary Accession number is Q8NGT2, with the entry name O13J1_HUMAN in the UniProt database . These identifiers allow researchers to access comprehensive information about the receptor's sequence, domains, and potential post-translational modifications through resources like UniProt and ExPASy . Additionally, OR13J1 is cataloged in the Kyoto Encyclopedia of Genes and Genomes (KEGG) under the identifier hsa:392309, providing context for its position within metabolic and signaling pathways . When reporting research on OR13J1, these standardized identifiers should be included to ensure clarity and facilitate cross-referencing with existing literature and databases.

How does OR13J1 fit into the broader context of human olfactory receptor genetics?

OR13J1 represents one receptor within the extensive family of human olfactory receptors, which comprises nearly 400 complete receptors . As of 2015, only 49-57 human olfactory receptors had been successfully deorphaned (had their activating ligands identified), highlighting the substantial knowledge gap that persists in the field . The number of deorphaned receptors has grown to exceed eighty as of recent estimates, though this still leaves the majority, potentially including OR13J1, as orphan receptors awaiting characterization . Understanding OR13J1 within this genetic context is crucial, as patterns of conservation, divergence, and specialization within the olfactory receptor family can provide insights into potential functions and ligand preferences. Comparative genomic approaches examining OR13J1 sequences across species could reveal evolutionary pressures and functionally important residues that might guide experimental design.

Ligand Binding Properties and Mechanisms

What approaches can be used to identify potential ligands for OR13J1?

Identifying ligands for orphan olfactory receptors like OR13J1 requires systematic screening approaches combined with functional validation. High-throughput screening techniques specifically designed for olfactory receptors have proven successful, as demonstrated by a 2015 study that identified agonists for 27 distinct odor receptors, 18 of which were previously orphan receptors . A dual-screening strategy, similar to that employed by Dietmar Krautwurst's team in 2016, could be adapted for OR13J1 investigation . This approach would entail comprehensive testing of diverse odorant molecules with OR13J1, followed by testing of promising candidates against the complete human OR array to establish specificity profiles . Computational methods based on pharmacophore modeling or molecular docking could complement experimental screening by predicting potential ligands based on structural similarities to known odorants that activate related receptors. Functional validation of candidate ligands would require expression systems that reliably produce active OR13J1, coupled with assays measuring receptor activation through calcium imaging, cAMP production, or other GPCR signaling readouts.

How might molecular dynamics simulations contribute to understanding OR13J1-ligand interactions?

Molecular dynamics (MD) simulations offer powerful tools for exploring the complex interactions between OR13J1 and potential ligands at the atomic level. These simulations can replicate the structural dynamics of olfactory receptors, including transitions between different conformational states, thereby overcoming limitations of static structural models . For OR13J1 research, MD simulations could elucidate potential binding modes and affinities with candidate odorant molecules, providing insights into how the receptor might recognize and interact with different chemical structures . Additionally, MD approaches can simulate the activation process of olfactory receptors, including interactions with G proteins and the intricate details of signal transduction mechanisms . This would contribute to understanding how OR13J1 transduces external chemical signals into intracellular biological responses. By leveraging known features of ligands and receptor structures, MD simulations could also predict novel antagonists and agonists for OR13J1, guiding experimental validation efforts .

Comparative Analysis with Other Olfactory Receptors

How does OR13J1 compare structurally and functionally to well-characterized olfactory receptors?

While specific comparative data for OR13J1 is limited in the available literature, general principles of olfactory receptor structure and function provide a framework for potential comparisons. Unlike the recently characterized OR51E2, which has been shown to "discern" the aroma of cheese through precise molecular interactions with propionic acid, the specific odorant preferences of OR13J1 remain to be determined . Structural comparisons would need to consider the binding pocket architecture, which in OR51E2 effectively entraps odorant molecules within a compact, enclosed space where both polar and hydrophobic interactions occur . Another point of comparison would be the expression pattern of OR13J1 relative to receptors like OR51E2, which is expressed not only in olfactory nerve cells but also in non-olfactory organs such as the prostate . This dual expression pattern has implications for receptor function beyond olfaction and may influence experimental strategies for heterologous expression. Sequence alignment and homology modeling using OR51E2 and other characterized receptors as templates could provide preliminary insights into structural and functional similarities or differences with OR13J1.

What challenges arise in comparing the binding mechanisms of OR13J1 with other olfactory receptors?

Comparative analysis of binding mechanisms across olfactory receptors presents several significant challenges. A fundamental difficulty lies in addressing how different receptors respond to stereoisomers, such as chiral isomers or functional group isomers . Questions regarding varying activation abilities of these isomers, the migration of optimal binding sites, and the binding conformations between odorant molecule ligands and different olfactory receptors have largely remained unaddressed in the literature . Understanding the intermolecular forces at play between functional groups of ligands and amino acid residues in the binding pockets of different olfactory receptors poses additional challenges . Furthermore, the dynamic nature of olfactory receptors, which undergo conformational changes between active and inactive states, introduces complexity when making structural comparisons . These challenges are compounded by the historical difficulty in expressing and purifying sufficient quantities of functional olfactory receptors for structural studies, although recent advances with receptors like OR51E2 provide promising methodological precedents .

Computational Approaches in OR13J1 Research

How can AlphaFold and other structural prediction tools be applied to study OR13J1?

What bioinformatic strategies can help predict OR13J1 function based on sequence analysis?

Several bioinformatic approaches can provide insights into OR13J1 function based on sequence information. Comparative sequence analysis across the olfactory receptor family can identify conserved motifs and variable regions that might correlate with ligand specificity or G-protein coupling preferences. Phylogenetic analysis placing OR13J1 within the evolutionary context of the olfactory receptor family could suggest functional similarities with more characterized relatives. Sequence-based prediction of post-translational modification sites might reveal regulatory mechanisms affecting receptor trafficking, stability, or signaling capabilities. Machine learning approaches trained on datasets of deorphaned olfactory receptors could potentially predict candidate ligand classes based on sequence features, although such predictions would require rigorous experimental validation. Additionally, analyzing the conservation of specific residues across species could highlight functionally critical positions within the receptor structure. These computational predictions should be viewed as hypothesis-generating tools that guide experimental design rather than definitive functional assignments.

Isolation and Purification Protocols

What are effective strategies for isolating OR13J1 from biological samples?

Isolating OR13J1 from biological samples presents significant challenges similar to those encountered with other olfactory receptors. An effective isolation strategy begins with careful sample collection and preparation, optimized for the specific tissue or cell type where OR13J1 is expressed. For tissue homogenates, a gentle mechanical disruption followed by differential centrifugation can help separate membrane fractions containing the receptor . Solubilization of membrane proteins requires careful selection of detergents that maintain protein structure and function; typically, mild non-ionic detergents or lipid-based methods like nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) may be suitable for GPCRs like OR13J1. Affinity-based purification methods using antibodies specific to OR13J1 or epitope tags engineered into recombinant versions could provide selective enrichment . Size exclusion chromatography or ion exchange chromatography might serve as additional purification steps to improve sample homogeneity. Throughout the isolation process, maintaining an appropriate buffer system that mimics the physiological environment is crucial to preserve receptor conformation and activity.

What quality control measures should be implemented when working with purified OR13J1?

Quality control for purified OR13J1 should encompass multiple analytical techniques to verify identity, purity, and functional integrity. SDS-PAGE followed by western blotting using specific antibodies can confirm the presence of OR13J1 at the expected molecular weight and assess sample purity . Mass spectrometry-based proteomics provides a more definitive identification and can detect post-translational modifications. Circular dichroism spectroscopy can evaluate secondary structure content, providing insights into proper protein folding. For functional assessment, ligand binding assays using known or predicted odorants would be ideal, though this may be challenging for orphan receptors like OR13J1 . Alternative functional tests might include evaluating G-protein coupling capabilities in reconstituted systems. Stability testing under various storage conditions is also essential, with the recommendation that loss rates should be less than 5% under appropriate conditions . Researchers should document batch-to-batch variability and establish acceptance criteria for purified receptor preparations to ensure experimental reproducibility.

Expression Systems and Optimization

What expression systems are most suitable for producing recombinant OR13J1?

Selecting an appropriate expression system for OR13J1 requires careful consideration of several factors influencing GPCR production. Heterologous expression in mammalian cell lines like HEK293 or CHO cells often provides the most native-like post-translational modifications and membrane composition for GPCRs, potentially yielding functionally active OR13J1 . Insect cell expression systems using baculovirus vectors represent another viable option, offering higher protein yields while maintaining many mammalian-like protein processing capabilities. For structural studies requiring larger protein quantities, yeast systems like Pichia pastoris or Saccharomyces cerevisiae might be considered, though glycosylation patterns will differ from mammalian systems. Cell-free expression systems could offer advantages for difficult-to-express proteins by eliminating cellular toxicity concerns. When designing expression constructs, researchers should consider incorporating purification tags, fluorescent reporters for trafficking studies, or stabilizing modifications based on successful strategies used for other olfactory receptors like OR51E2 . Expression in non-olfactory systems may benefit from co-expression with accessory proteins that facilitate proper folding and trafficking.

What strategies can improve the stability and functionality of recombinant OR13J1?

Improving the stability and functionality of recombinant OR13J1 requires addressing the inherent challenges of membrane protein expression. Codon optimization for the chosen expression system can enhance translation efficiency and protein yield. The addition of signal sequences may improve membrane targeting, while fusion partners like T4 lysozyme or thermostabilized apocytochrome b562 (BRIL) inserted into intracellular or extracellular loops could enhance stability for structural studies, following approaches successful with other GPCRs . Introduction of disulfide bridges or point mutations based on computational predictions might increase thermostability without compromising function. Careful selection of detergents and lipids during purification and reconstitution is crucial, as these components profoundly affect GPCR stability and activity . Cholesterol supplementation often benefits GPCR stability in membrane mimetics. For long-term storage, researchers might explore protein engineering approaches such as consensus-based stabilizing mutations or directed evolution strategies to select for OR13J1 variants with enhanced stability while maintaining ligand-binding properties. When assessing functionality, it's important to note that recombinant proteins may have different properties compared to native OR13J1 .

Functional Assays and Binding Measurements

What functional assays can effectively measure OR13J1 activity?

Several functional assays can be adapted to measure OR13J1 activity, focusing on different aspects of the receptor signaling cascade. Calcium imaging represents a widely used approach for olfactory receptors, detecting intracellular calcium flux following receptor activation through fluorescent indicators like Fura-2 or genetically encoded calcium sensors . cAMP assays using luminescence or fluorescence-based reporters can measure changes in second messenger levels resulting from G-protein activation. BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer) assays offer more direct measurement of receptor-G protein interactions or receptor conformational changes. Electrophysiological techniques such as patch-clamp recording might be applicable in cellular contexts where OR13J1 activation triggers measurable current changes. For deorphaning studies, a research strategy similar to that employed by Mainland et al. (2015) could be adapted, using high-throughput screening techniques to identify potential agonists . Alternatively, the dual-screening approach developed by Krautwurst's team, testing diverse odorant molecules against OR13J1, could provide a systematic framework for functional characterization .

How can binding affinity and specificity of ligands to OR13J1 be accurately measured?

Measuring binding affinity and specificity between OR13J1 and potential ligands requires specialized techniques that account for the challenges of membrane protein-small molecule interactions. Radioligand binding assays represent a traditional approach, using radiolabeled ligands to measure direct binding parameters like dissociation constants (Kd) and binding capacities (Bmax), though this requires prior identification of a ligand with high affinity for OR13J1 . Surface plasmon resonance (SPR) or microscale thermophoresis (MST) offer label-free alternatives for measuring binding kinetics and thermodynamics. Isothermal titration calorimetry (ITC) provides direct measurement of binding energetics but typically requires larger protein quantities. For orphan receptors like OR13J1, competitive binding assays may be designed once initial ligands are identified, allowing screening of multiple compounds. Computational approaches like molecular docking and molecular dynamics simulations can complement experimental measurements by predicting binding poses and energetics . When designing binding studies, researchers should consider that olfactory receptors often respond to multiple odorants with varying affinities, and binding measurements should be interpreted within this context of promiscuous recognition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.