Recombinant Human Olfactory receptor 14A16 (OR14A16)

Shipped with Ice Packs
In Stock

Description

Expression Platforms

  • HEK293 Cell Lines: Stable tetracycline-inducible HEK293S cells are widely used for OR14A16 expression, yielding monomeric (1.6 mg) and dimeric (1.1 mg) forms from 60 T175 flasks .

  • Cell-Free Synthesis: Wheat germ and HEK-293 systems enable rapid production of Strep- or His-tagged OR14A16 with >70% purity .

Purification Methods

  • Immunoaffinity Chromatography: Anti-FLAG antibodies isolate detergent-solubilized receptors .

  • Gel Filtration: Size exclusion chromatography separates monomeric and dimeric forms .

Ligand Binding Assays

  • Intrinsic Tryptophan Fluorescence: Quantifies ligand affinity (e.g., micromolar-range binding to dihydrojasmone) .

  • Real-Time cAMP Assays: Measures receptor activation via Gαs/olf-coupled pathways in heterologous cells .

Olfactory Sensor Arrays

OR14A16-expressing HEK293T cells are integrated into microwell arrays for real-time odorant screening. Fluorescence-based detection (GCaMP) enables simultaneous analysis of 388 human ORs .

Antibody and Diagnostic Tools

  • Anti-OR14A16 Antibodies: Used in Western blot (1:500–2000 dilution) and ELISA (1:5000–20000 dilution) .

  • Quantitative ELISA Kits: Detect OR14A16 in tissue homogenates (sensitivity: 0.156–10 ng/ml) .

Current Limitations and Future Directions

  • Ligand Specificity: No physiological ligands are confirmed, necessitating high-throughput screens like M2OR database analyses .

  • Structural Data: No crystallographic or NMR structures exist, hindering mechanistic studies .

Table 1: Key Properties of Recombinant OR14A16

PropertyValue/DescriptionSource
Molecular Weight34,307 Da
Expression HostsHEK293, Wheat Germ
Purification TagsFLAG, rho1D4, Strep, His
Detection Range (ELISA)0.156–10 ng/ml

Table 2: Functional Assays

Assay TypeApplicationReference
cAMP MeasurementReal-time receptor activation
Fluorescence-Based ScreeningOdorant responsiveness profiling

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
OR14A16; OR5AT1; Olfactory receptor 14A16; Olfactory receptor 5AT1; Olfactory receptor OR1-45
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR14A16
Target Protein Sequence
MANLTIVTEFILMGFSTNKNMCILHSILFLLIYLCALMGNVLIIMITTLDHHLHTPVYFF LKNLSFLDLCLISVTAPKSIANSLIHNNSISFLGCVSQVFLLLSSASAELLLLTVMSFDR YTAICHPLHYDVIMDRSTCVQRATVSWLYGGLIAVMHTAGTFSLSYCGSNMVHQFFCDIP QLLAISCSENLIREIALILINVVLDFCCFIVIIITYVHVFSTVKKIPSTEGQSKAYSICL PHLLVVLFLSTGFIAYLKPASESPSILDAVISVFYTMLPPTFNPIIYSLRNKAIKVALGM LIKGKLTKK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15022

KEGG: hsa:284532

STRING: 9606.ENSP00000350248

UniGene: Hs.626620

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR14A16 and what is its role in the olfactory system?

OR14A16 (Olfactory Receptor Family 14 Subfamily A Member 16) is a protein encoded by the OR14A16 gene in humans. It belongs to the G-protein coupled receptor 1 family and functions as an odorant receptor in the olfactory system. Like other olfactory receptors, OR14A16 initiates a neuronal response upon interaction with specific odorant molecules, eventually triggering the perception of smell. Olfactory receptors operate through a combinatorial code, where a single odorant can activate multiple receptors, and each receptor can respond to several different odorants . This receptor, like other ORs, shares a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and is responsible for the recognition and G protein-mediated transduction of odorant signals .

What is the molecular structure of OR14A16?

OR14A16 is a 309 amino acid protein that belongs to the G-protein coupled receptor 1 family . Like other olfactory receptors, it has a characteristic seven-transmembrane domain structure typical of GPCRs. The protein contains an extracellular N-terminus, seven transmembrane α-helical domains connected by three extracellular and three intracellular loops, and an intracellular C-terminus. The binding pocket for odorant molecules is formed by the transmembrane domains, with specific amino acid residues responsible for ligand recognition and selectivity. The intracellular domains of OR14A16 interact with G proteins, particularly the olfactory-specific G protein α subunit (GNAL/Gαolf), to initiate signal transduction upon odorant binding .

What known protein-protein interactions does OR14A16 engage in?

String database analysis reveals that OR14A16 has several predicted functional partners involved in olfactory signal transduction:

ProteinDescriptionInteraction Score
GNALGuanine nucleotide-binding protein G(olf) subunit alpha; involved as modulator or transducer in transmembrane signaling systems0.686
GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1; required for GTPase activity0.682
ARRB2Beta-arrestin-2; regulates GPCR signaling by mediating receptor desensitization and resensitization0.679
ARRB1Beta-arrestin-1; functions in regulating agonist-mediated GPCR signaling(Not fully specified)

These interactions are critical for the proper functioning of OR14A16 in olfactory signal transduction pathways .

What are the challenges in expressing recombinant OR14A16 in heterologous systems?

Expression of olfactory receptors, including OR14A16, in heterologous systems presents significant challenges primarily due to poor cell surface expression. This is a common issue with many olfactory receptors, making it difficult to express them on the cell surface and enable them to respond to odor molecules . The hydrophobic nature of the seven transmembrane domains can lead to protein misfolding, aggregation, and retention in the endoplasmic reticulum. Additionally, mammalian cells often lack the specialized molecular machinery found in olfactory sensory neurons that facilitate proper OR trafficking and function. These challenges have historically limited the functional characterization of ORs, including OR14A16, in recombinant systems .

What expression systems are most effective for studying recombinant OR14A16?

Human embryonic kidney-derived HEK293 cells have emerged as one of the most effective heterologous systems for OR expression when modified with appropriate accessory proteins. Specifically, HEK293 cells engineered to express chaperones like Receptor-Transporting Protein 1 (RTP1), RTP2, and Receptor Expression-Enhancing Protein 1 (REEP1) - collectively known as Hana3A cells - show greatly improved cell surface expression of ORs . For OR14A16 specifically, the use of RTP1S (a C-terminal shortened version of RTP1) has been shown to more strongly improve cell surface expression and odor molecule responses . Additionally, co-expression with non-OR GPCRs such as β2-adrenergic receptor or M3 muscarinic acetylcholine receptor can form heterodimers with ORs, improving their trafficking to the cell surface .

What tags and modifications improve the expression and detection of recombinant OR14A16?

Several tags and modifications have been demonstrated to improve the expression and detection of olfactory receptors, including OR14A16:

  • N-terminal Rho-tag (rhodopsin-derived signal peptide): Enhances cell surface expression

  • Lucy-tag: Enables cell surface expression for a wider range of ORs than the Rho-tag

  • IL-6-Halo-tag: Also improves surface expression for diverse ORs

Additionally, co-expression with olfactory-specific G protein α (GNAL/Gαolf), which has high affinity for ORs, and Ric-8B, a chaperone of Gα protein, improves signal transduction. For detection purposes, GloSensor™, a highly sensitive luciferase for cAMP detection, has proven valuable in assessing OR activation .

What are the recommended methods for measuring OR14A16 activation in real-time?

Real-time measurement of OR14A16 activation is crucial for accurate functional characterization, as continuous exposure to odorants for extended periods can lead to odorant denaturation or cytotoxicity, potentially confounding results . A recommended approach is the human olfactory receptor-expressing cell array sensor system, which allows for simultaneous and real-time measurement of OR responses to odorants .

This system involves:

  • Transfection of HEK293T cells with OR14A16 and accessory proteins

  • Loading cells with calcium-sensitive fluorescent dye (e.g., Fluo-4 AM)

  • Creating a microwell array containing OR-expressing cells

  • Continuous perfusion with Ringer's solution containing the odorant of interest

  • Real-time fluorescence imaging to capture calcium responses

  • Data mining of fluorescence intensity changes at single-cell resolution

For OR14A16 specifically, significant responses are typically defined as fluorescence intensity changes of 5% or more relative to baseline. Machine learning algorithms can help distinguish odor-specific responses from spontaneous calcium fluctuations, reducing coefficient of variation to approximately 10% .

How can researchers address the problem of non-specific activation when studying OR14A16?

Non-specific activation presents a significant challenge when studying olfactory receptors. To address this issue with OR14A16, researchers should implement several controls and methodological approaches:

  • Include vector-only transfected cells as negative controls in all experiments

  • Perform dose-response experiments to establish concentration-dependent activation profiles

  • Use antagonist controls where available to confirm specificity

  • Implement machine learning algorithms to distinguish between spontaneous cellular activity and true odorant-induced responses

  • Normalize responses against known positive controls

  • Consider the temporal dynamics of responses, as true odorant-induced responses often have characteristic kinetic profiles

Additionally, researchers should be aware that each cell exhibits spontaneous non-specific fluorescence due to intracellular Ca²⁺ mobilization from normal cellular activity. Processing temporal changes in fluorescence using machine learning approaches can help extract actual changes due to odor-responsive ORs from background noise .

What concentrations of odorants are appropriate for OR14A16 functional studies?

Odorant concentration significantly influences OR activation and subsequent cellular responses. For OR14A16 functional studies, appropriate concentration ranges differ between simple and complex odorants:

  • For simple odorant molecules: 0.01–0.1 mM

  • For complex odorant molecules: 0.05–5.0 mM

It's crucial to note that olfactory perception is highly dependent on odorant concentration, and changes in concentration can lead to different perceptions of hedonicity or olfactory quality . From a molecular perspective, increasing ligand concentration results in a higher probability of OR activation and stronger cellular signaling. A molecule that doesn't induce any response at low concentrations may activate multiple ORs at higher concentrations . Therefore, researchers should always perform dose-response experiments when characterizing OR14A16 responses to specific odorants.

How should researchers analyze and interpret fluorescence data from OR14A16 activation assays?

Analysis and interpretation of fluorescence data from OR14A16 activation assays require a systematic approach:

  • Baseline normalization: Calculate the average fluorescence intensity for 10 seconds before odorant addition and normalize all subsequent measurements to this baseline .

  • Response quantification: Define significant responses as fluorescence intensity changes of 5% or more relative to baseline .

  • Single-cell analysis: Extract fluorescence intensity changes at a single-cell basis, typically using four pixels per cell with image processing software like ImageJ .

  • Data averaging: Extract dozens of actual fluorescence intensity changes per OR and average them to suppress biological fluctuations to approximately 10% coefficient of variation .

  • Temporal analysis: Analyze not just peak responses but also response kinetics, including activation rate, deactivation rate, and response duration.

  • Odor matrix generation: Represent various odors by the response intensity of all tested human ORs, including OR14A16, to create an "odor matrix" that captures the combinatorial nature of olfactory coding .

Machine learning approaches can significantly enhance data analysis by distinguishing true responses from background fluctuations and identifying patterns across multiple experiments and odorants.

What bioinformatic tools are available for predicting OR14A16 ligand interactions?

Several bioinformatic tools and databases are available for predicting and analyzing OR14A16 ligand interactions:

  • M2OR database: The largest and most comprehensive database of OR-molecule experiments, containing information on responsive and non-responsive OR-molecule pairs, bioassay methodologies, stereochemistry, and odorant concentrations .

  • STRING database: Provides protein-protein interaction networks including OR14A16's interactions with signaling proteins like GNAL, GNB1, and beta-arrestins .

  • Molecular docking software: Tools like AutoDock, GOLD, or Glide can be used to model the binding of potential ligands to homology models of OR14A16.

  • Machine learning predictors: Recent developments in AI-based approaches allow for the prediction of OR-ligand interactions based on molecular features and known interaction patterns.

These tools can guide experimental design by identifying potential ligands for OR14A16 and providing structural insights into ligand binding mechanisms.

How does OR14A16 function within the combinatorial code of olfaction?

OR14A16, like other olfactory receptors, functions within a combinatorial coding system where odorant perception relies on the pattern of activation across multiple receptors rather than a dedicated receptor for each odor . Understanding OR14A16's role in this combinatorial code requires consideration of several factors:

Research into the precise odorant response profile of OR14A16 and its coactivation patterns with other receptors will elucidate its specific contribution to the complex combinatorial code of human olfaction.

What is known about genetic variations in OR14A16 and their functional consequences?

Genetic variations in olfactory receptors contribute significantly to individual differences in olfactory perception. For OR14A16, several types of genetic variations may impact its function:

  • Single nucleotide polymorphisms (SNPs): May alter amino acid sequences in critical regions such as the ligand-binding pocket or G-protein interaction domains.

  • Copy number variations: Some individuals may have duplicate copies or deletions of the OR14A16 gene.

  • Alternative splicing: Different splice variants may result in receptors with altered functional properties.

Research indicates that even minor alterations in the functionality of a single olfactory receptor can lead to notable perceptual consequences . Genetic variations in OR14A16 may therefore contribute to individual differences in the perception of specific odorants recognized by this receptor. A comprehensive analysis of OR14A16 genetic variations across populations, coupled with functional studies of variant receptors, would provide valuable insights into the molecular basis of olfactory perception diversity.

How can OR14A16 be incorporated into artificial olfactory systems or biosensors?

OR14A16 offers potential applications in developing artificial olfactory systems or biosensors for specific chemical detection. Implementation strategies include:

  • Cell-based biosensors: Incorporating OR14A16-expressing cells into microfluidic devices with integrated signal detection systems to create portable odorant sensors .

  • Nanodisc or liposome systems: Embedding purified OR14A16 into artificial membrane systems coupled with label-free detection methods such as surface plasmon resonance or impedance measurements.

  • Electronic nose integration: Using OR14A16 response data to train electronic nose devices, enhancing their discrimination capabilities for specific odorant classes.

  • Field-effect transistor (FET)-based sensors: Coupling OR14A16 to gate materials in FET devices for electrical detection of binding events.

The human olfactory receptor-expressing cell array sensor approach described in the literature provides a foundation for developing more sophisticated biosensing platforms incorporating OR14A16 . This approach allows for real-time measurement of receptor responses in a high-throughput format suitable for adaptation to portable sensing devices.

What are common troubleshooting approaches for poor OR14A16 expression in recombinant systems?

Poor expression of OR14A16 in recombinant systems is a common challenge. Researchers can implement several troubleshooting approaches:

  • Optimize codon usage: Adjust codon usage to match the expression host for improved translation efficiency.

  • Test different tags and fusion partners: Systematically evaluate different N-terminal tags beyond the standard Rho-tag, such as the Lucy-tag or IL-6-Halo-tag, which may better facilitate OR14A16 expression .

  • Adjust chaperone co-expression: Optimize the ratio of RTP1S, RTP2, and REEP1 co-expression, as these accessory proteins can significantly improve surface expression .

  • Try alternative cell lines: While Hana3A cells (modified HEK293) are standard, different OR variants may express better in alternative cell backgrounds.

  • Co-express complementary GPCRs: Co-expression with non-OR GPCRs like β2-adrenergic receptor or M3 muscarinic acetylcholine receptor may improve trafficking to the cell surface through heterodimer formation .

  • Optimize culture conditions: Adjust temperature (e.g., culture at 30°C instead of 37°C) and chemical chaperones (e.g., DMSO, glycerol) to improve protein folding.

  • Consider inducible expression systems: Regulated expression may reduce toxicity associated with constitutive OR overexpression.

How can researchers differentiate between direct OR14A16 activation and off-target effects in functional assays?

Differentiating between direct OR14A16 activation and off-target effects requires rigorous experimental controls:

  • Perform experiments with non-transfected cells: To establish baseline responses of the host cell line to test odorants.

  • Include vector-only controls: To account for effects of the transfection process without OR expression.

  • Use structurally related odorants: Compare responses to closely related molecules to establish structure-activity relationships specific to OR14A16.

  • Conduct competitive binding assays: If known ligands exist, use competition assays to confirm binding to the same site.

  • Employ site-directed mutagenesis: Mutate key residues predicted to be involved in ligand binding to confirm direct interaction.

  • Assess G-protein coupling specificity: Use pertussis toxin or G-protein subtype-specific inhibitors to confirm the expected signaling pathway.

  • Apply receptor antagonists: Where available, antagonists can help confirm specificity of the response.

  • Compare responses across different assay systems: Consistent results across different assay platforms (calcium imaging, cAMP accumulation, etc.) suggest direct receptor activation rather than off-target effects.

What factors affect reproducibility in OR14A16 functional studies and how can they be controlled?

Several factors can affect reproducibility in OR14A16 functional studies:

  • Variability in expression levels: Standardize transfection conditions and consider using stable cell lines with defined expression levels.

  • Odorant volatility and stability: Store odorants properly, prepare fresh solutions before experiments, and use closed perfusion systems to maintain consistent concentrations .

  • Cell passage number and condition: Use cells within a defined passage range and standardize cell culture conditions.

  • Assay timing: Standardize the time post-transfection for conducting assays, as receptor expression and trafficking change over time.

  • Detection system sensitivity: Calibrate detection systems regularly and use internal standards to normalize between experiments.

  • Environmental factors: Control temperature, humidity, and CO₂ levels during experiments, as these can affect cellular responses.

  • Data analysis parameters: Establish and adhere to consistent data processing and analysis protocols, including threshold settings for response detection .

To enhance reproducibility, researchers should document all experimental parameters thoroughly, use automated systems where possible, and include both positive and negative controls in each experiment. Additionally, the implementation of machine learning approaches for data analysis can help identify and correct for experimental variability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.