Recombinant Human Olfactory receptor 1A1 (OR1A1)-VLPs

Shipped with Ice Packs
In Stock

Description

Production and Purification Methodology

The manufacturing process involves:

  1. Stable Transfection: Tetracycline-inducible HEK293 cells engineered with dual epitope tags (FLAG-rho1D4)

  2. Membrane Extraction: Detergent solubilization using n-dodecyl-β-D-maltopyranoside

  3. Affinity Purification: Two-step protocol combining anti-FLAG immunoaffinity chromatography and size-exclusion chromatography

  4. VLP Assembly: Incorporation into lipid bilayers during ultracentrifugation steps

Typical yields reach 1.6 mg monomeric and 1.1 mg dimeric receptor per 60 T175 flasks .

Odorant Binding Studies

OR1A1-VLPs demonstrate micromolar affinity for ligands like:

  • (+)-Dihydrojasmone (KdK_d = 3.2 μM)

  • (+)-Carvone (EC₅₀ = 10 μM in cAMP assays)

  • Citronellal (docking distance <4 Å to Tyr251 residue)

The system enabled identification of four novel n-hexanal-responsive receptors through enhanced signal amplification .

Technical Advantages Over Conventional Expression

ParameterMammalian VLPsE. coli Expressed
Surface Density17-137× higher Baseline
Functional Yield1.1-1.6 mg/60 flasks 0.2-0.5 mg/L culture
Ligand SensitivityDetects 10⁻⁶ M odorants Requires 10⁻⁴ M

The TAR-Tat transcriptional enhancement system increases mRNA levels 52-fold compared to traditional vectors .

Challenges and Limitations

  1. Thermostability: Requires storage at -80°C with 6% trehalose

  2. Activity Loss: 40% reduction after 3 freeze-thaw cycles

  3. Dimerization Effects: Altered ligand affinity in dimeric vs monomeric forms

Future Directions

  1. High-Throughput Screening: Adaptation for odorant library screening

  2. Biosensor Development: Integration with graphene field-effect transistors

  3. Therapeutic Applications: Exploring GPCR signaling pathways in neurodegenerative diseases

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery times.
Note: Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receipt, and ensure to avoid repeated freezing and thawing, as it will affect the protein activity.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please let us know and we will verify if it is possible to develop.
Synonyms
OR1A1; Olfactory receptor 1A1; Olfactory receptor 17-7; OR17-7; Olfactory receptor OR17-11
Datasheet & Coa
Please contact us to get it.
Expression Region
1-309aa
Research Area
Neuroscience
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Molecular mechanism of activation of human musk receptors OR5AN1 and OR1A1 by (R)-muscone and diverse other musk-smelling compounds. PMID: 29632183
  2. OR1A1 activation suppresses hepatic triglyceride metabolism by modulating HES-1, PPARG, and mtGPAT expression. PMID: 25817041
  3. Evolutionary conserved amino acid residues to be necessary for specific responsiveness of OR1A1 to odorants were identified. PMID: 17601748
Database Links

HGNC: 8179

KEGG: hsa:8383

STRING: 9606.ENSP00000305207

UniGene: Hs.532688

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR1A1 and what distinguishes it from other olfactory receptors?

OR1A1 is a member of the olfactory receptor family, which comprises the largest G protein-coupled receptor (GPCR) gene superfamily. Olfactory receptors are traditionally associated with smell perception but are increasingly recognized for their expression and function in non-olfactory tissues .

OR1A1 is distinguished by its relatively simple ligand binding requirements and structural characteristics. Unlike many other olfactory receptors that may require complex molecular structures for activation, OR1A1 interacts with smaller, simpler molecular structures, typically with molecular weights around 140 Da . This simplicity in ligand requirements makes OR1A1 particularly interesting for structure-function studies and recombinant expression systems.

The receptor demonstrates particular sensitivity to certain compounds such as (-)-carvone, which has been established as a known OR1A1 ligand capable of triggering specific downstream signaling pathways . Unlike broadly tuned olfactory receptors such as MOR256-17 which respond to multiple diverse odorants, OR1A1 appears to have more selective ligand preferences, making it valuable for studying specificity in GPCR-ligand interactions.

How does the molecular structure of OR1A1 relate to its ligand-binding properties?

The ligand-binding properties of OR1A1 are directly influenced by its three-dimensional structure as a seven-transmembrane GPCR. Computational modeling studies have been employed to establish homology models of OR1A1 to determine the functional groups involved in ligand interaction .

The binding pocket of OR1A1 appears specialized for interactions with relatively small molecules (approximately 140 Da) that possess specific functional groups. Research indicates that the corralled intensity of molecular vibrational frequency (CIMVF) can be used as a molecular descriptor to explore the contact sites between OR1A1 and its ligands . This approach has allowed researchers to differentiate between agonists and non-agonists based on their molecular vibration patterns.

In experimental validations, datasets of 106 chemical compounds (53 agonists and 53 non-agonists) have been analyzed through geometric optimization and molecular vibrational pattern analysis to characterize the binding mode through computational simulation . These studies suggest that specific vibrational frequencies may be critical for activating OR1A1, providing insights into the mechanistic basis of ligand recognition.

What signaling pathways are activated by OR1A1 in response to ligand binding?

OR1A1 activation triggers specific G protein-coupled signaling cascades that vary depending on the cellular context. In hepatocytes, stimulation of OR1A1 by (-)-carvone increases cyclic adenosine monophosphate (cAMP) levels without affecting intracellular calcium concentrations . This selective cAMP elevation leads to activation of protein kinase A (PKA), which subsequently phosphorylates cAMP response element-binding protein (CREB) .

The phosphorylated CREB upregulates expression of hairy and enhancer of split (HES)-1, which functions as a corepressor of peroxisome proliferator-activated receptor-γ (PPAR-γ) in hepatocytes . This suppression of PPAR-γ results in reduced expression of mitochondrial glycerol-3-phosphate acyltransferase, a key enzyme in triglyceride synthesis.

The complete signaling pathway can be summarized as:
OR1A1 activation → cAMP increase → PKA activation → CREB phosphorylation → HES-1 upregulation → PPAR-γ repression → reduced triglyceride synthesis

This signaling cascade demonstrates that OR1A1 functions as a non-redundant receptor in hepatocytes that regulates the PKA-CREB-HES-1 signaling axis and thereby modulates hepatic triglyceride metabolism .

What are the optimal expression systems for producing recombinant OR1A1-VLPs?

For successful production of recombinant OR1A1-VLPs, researchers should consider expression systems that accommodate membrane proteins while facilitating proper folding and assembly into virus-like particles. Based on experimental approaches for GPCR expression, several systems have proven effective:

Xenopus laevis oocyte expression systems have been successfully used for functional studies of olfactory receptors including members of the olfactory receptor family . This system allows for electrophysiological assessment of receptor function through co-expression with signaling components such as Gα proteins and channel proteins like CFTR .

For VLP production specifically, mammalian cell lines such as HEK293 and insect cell expression systems using baculovirus are most commonly employed due to their ability to facilitate proper folding and post-translational modifications of complex membrane proteins. When expressing OR1A1 in these systems, the addition of N-terminal tags or fusion partners such as the rhodopsin N-terminal extension can improve surface expression and incorporation into VLPs .

The methodology should include:

  • Codon optimization for the selected expression system

  • Addition of N-terminal tags to improve expression

  • Temperature optimization (typically 30°C for mammalian cells)

  • Addition of chemical chaperones or ligands during expression

  • Optimal detergent selection for membrane protein solubilization

What modifications to OR1A1 can enhance its stability and functionality in VLP systems?

Several strategic modifications to the native OR1A1 sequence can significantly enhance both stability and functionality when incorporated into VLPs:

N-terminal modifications have been demonstrated to improve surface expression of olfactory receptors. Adding the first 20 amino acids of rhodopsin as an N-terminal extension has been shown to enhance the expression of several olfactory receptors including members of the olfactory receptor family in heterologous expression systems . This approach facilitates proper trafficking to the plasma membrane, which is essential for subsequent incorporation into VLPs.

Codon optimization for the expression system of choice can substantially increase protein yields. For VLP production in mammalian cells, human-optimized codons should be employed, while insect cell expression would benefit from insect-optimized codons.

The addition of specific stabilizing mutations can enhance the conformational stability of OR1A1. These mutations can be identified through computational approaches or directed evolution methods. When designing these modifications, researchers should be mindful of preserving the binding site architecture required for interaction with ligands such as (-)-carvone .

For experimental validation of OR1A1 functionality after modification, electrophysiological assays similar to those used for other olfactory receptors can be employed, where OR1A1 activation is measured through co-expressed reporter systems such as CFTR channels activated via the cAMP pathway .

How can VLP morphology be optimized to maximize OR1A1 incorporation and orientation?

Optimizing VLP morphology for maximum OR1A1 incorporation requires careful consideration of various parameters:

The choice of VLP scaffold protein significantly impacts receptor incorporation efficiency. When selecting a scaffold, researchers should consider:

  • Size compatibility: Smaller VLP scaffolds (20-30 nm) often provide better incorporation efficiency

  • Membrane interaction: Scaffolds with intrinsic membrane-binding domains facilitate OR1A1 incorporation

  • Flexibility: Scaffolds allowing conformational adaptability better accommodate membrane proteins

Lipid composition of the VLP membrane directly affects OR1A1 stability and orientation. Based on research with other GPCRs, a lipid composition that mimics native cell membranes is recommended, typically including:

  • Cholesterol (20-30 mol%)

  • Phosphatidylcholine (40-50 mol%)

  • Phosphatidylethanolamine (20-25 mol%)

  • Phosphatidylserine (5-10 mol%)

This composition promotes proper folding and maintains the seven-transmembrane structure necessary for ligand binding and signaling functions.

Optimization strategies should include cryo-electron microscopy verification of protein orientation and density on the VLP surface, as well as functional assays to confirm that incorporated OR1A1 maintains ligand-binding capacity, particularly to established ligands such as (-)-carvone .

How can researchers effectively screen for novel OR1A1 ligands using the VLP system?

Researchers can implement a multi-phase approach to screen for novel OR1A1 ligands using OR1A1-VLPs:

Initial computational screening: Begin with in silico methods based on known OR1A1 ligands such as (-)-carvone . Computational approaches should consider:

  • Molecular weight filtering (targeting compounds around 140 Da)

  • Molecular vibration pattern analysis using CIMVF methodology

  • Structural similarity to known agonists from the validated dataset of 53 agonists previously studied

Primary functional screening: OR1A1-VLPs can be utilized in a high-throughput primary screen using:

  • Fluorescence-based assays measuring conformational changes upon ligand binding

  • BRET/FRET-based proximity assays detecting OR1A1 interaction with downstream signaling proteins

  • Label-free technologies such as surface plasmon resonance to detect direct binding events

Secondary validation: Confirmed hits should be validated using cellular systems to verify functional activation:

  • cAMP accumulation assays, as OR1A1 activation increases cAMP without affecting calcium levels

  • PKA activity measurements to confirm downstream signaling activation

  • Gene expression analysis focusing on HES-1 upregulation as a marker of OR1A1 pathway activation

A methodical table for screening potential ligands could be structured as follows:

Screening PhaseMethodologyKey ParametersExpected Outcomes
ComputationalMolecular dockingBinding energy < -7.0 kcal/molIdentify 100-200 candidates
ComputationalCIMVF analysisVibration patterns similar to (-)-carvoneNarrow to 50-75 candidates
PrimaryVLP-based binding assayKd < 50 μMIdentify 10-20 hits
SecondarycAMP accumulationEC50 < 100 μMConfirm 5-10 agonists
ValidationPKA/CREB phosphorylationSignificant increase vs. controlValidate 3-5 ligands

What are the differences in OR1A1 response to various ligands in the VLP system versus cellular systems?

The differential responses of OR1A1 to ligands between VLP systems and cellular models represent important considerations for research interpretation:

Comparative ligand sensitivity: OR1A1-VLPs typically demonstrate altered dose-response relationships compared to cellular systems. For instance, while (-)-carvone activates OR1A1 signaling in hepatocytes leading to reduced intracellular triglyceride levels , the same ligand in VLP systems may exhibit:

  • Higher EC50 values due to diffusion limitations through the VLP structure

  • Altered Hill coefficients reflecting differences in cooperative binding

  • Different maximum response plateaus due to the absence of signal amplification mechanisms

Signaling pathway variations: In cellular systems, OR1A1 activation by (-)-carvone triggers the complete PKA-CREB-HES-1 signaling axis , whereas VLP systems typically only report the initial binding and conformational change events without downstream signaling components.

Influence of membrane environment: The lipid composition of VLPs differs from native cellular membranes, potentially affecting:

  • Receptor conformation and baseline activity

  • Lateral mobility and potential dimerization

  • Interaction with membrane-associated components

To accurately translate findings between systems, researchers should employ calibration curves using reference agonists like (-)-carvone and establish system-specific normalization factors. This approach enables more reliable extrapolation of structure-activity relationships across experimental platforms.

How can researchers quantify the binding affinity of different ligands to OR1A1-VLPs?

Quantifying binding affinity of ligands to OR1A1-VLPs requires specialized methodologies that account for the unique properties of membrane proteins in a VLP context:

Direct binding assays: For precise affinity measurements, researchers can employ:

  • Isothermal titration calorimetry (ITC) with purified OR1A1-VLPs to determine thermodynamic binding parameters

  • Microscale thermophoresis (MST) utilizing the intrinsic fluorescence of OR1A1-VLPs or labeled ligands

  • Surface plasmon resonance (SPR) with immobilized OR1A1-VLPs to measure association and dissociation kinetics

Competitive binding assays: Using a known ligand such as (-)-carvone as a competitor:

  • Fluorescently labeled (-)-carvone displacement assays

  • Radioligand competition binding with tritiated reference ligands

  • Time-resolved FRET competition assays using lanthanide chelates

Functional response measurements: Indirect estimation of binding affinity through:

  • Dose-response curves measuring conformational changes in the receptor

  • GTPγS binding assays when G proteins are reconstituted with OR1A1-VLPs

  • Bioluminescence resonance energy transfer (BRET) between OR1A1 and beta-arrestin or G proteins

When analyzing binding data, researchers should account for potential cooperativity and multiple binding sites. Scatchard analysis or nonlinear regression models can be applied to determine Kd values, with results typically presented as follows:

LigandDirect Binding Kd (μM)Competition Ki (μM)Functional EC50 (μM)Hill Coefficient
(-)-Carvone5-15Reference10-300.8-1.2
(+)-Carvone15-4025-6040-800.7-1.0
Benzaldehyde30-7050-10060-1200.9-1.1
2-Heptanone20-5030-8050-1000.8-1.0

How can OR1A1-VLPs be adapted for studying OR1A1's role in non-olfactory tissues?

OR1A1-VLPs offer unique opportunities for studying this receptor's functions beyond olfactory tissues, particularly in metabolic contexts:

Tissue-specific membrane composition: To accurately recapitulate OR1A1 function in specific tissues, researchers can modify VLP membranes to match tissue-specific lipid compositions:

  • For hepatocyte studies, VLPs should incorporate higher phosphatidylcholine and cholesterol content to mimic liver cell membranes

  • For adipocyte investigations, higher sphingomyelin and ceramide components would be appropriate

  • For neuronal tissue models, increased phosphatidylserine and ganglioside content is recommended

Reconstitution with tissue-specific signaling components: VLPs can be co-reconstituted with:

  • Liver-specific G protein subtypes to study hepatic signaling pathways

  • PKA and CREB components to recapitulate the hepatic signaling cascade observed in OR1A1 activation

  • HES-1 and PPAR-γ to model the complete signaling pathway affecting triglyceride metabolism

Application in metabolic disease models: OR1A1-VLPs can provide valuable insights into metabolic disorders by:

  • Screening for compounds that modulate OR1A1-mediated reduction in triglyceride levels

  • Investigating potential dysregulation of OR1A1 signaling in steatosis or non-alcoholic fatty liver disease

  • Exploring the connection between OR1A1 activation and expression of key enzymes in lipid metabolism pathways

These adaptations allow researchers to isolate the specific contribution of OR1A1 to cellular functions across different tissues, facilitating the development of tissue-targeted therapeutic approaches that modulate OR1A1 activity.

What methodologies can be employed to study the structural changes in OR1A1 upon ligand binding in the VLP context?

Advanced biophysical techniques can reveal the structural dynamics of OR1A1 upon ligand binding when incorporated into VLPs:

Time-resolved spectroscopic approaches:

  • Site-directed fluorescence labeling at key residues with environmentally sensitive fluorophores

  • Fluorescence resonance energy transfer (FRET) between strategically placed donor-acceptor pairs to monitor conformational changes

  • Time-resolved fluorescence spectroscopy to detect subtle changes in microenvironment upon ligand binding

Advanced microscopy techniques:

  • Single-particle cryo-electron microscopy (cryo-EM) of OR1A1-VLPs in both apo and ligand-bound states

  • High-speed atomic force microscopy (HS-AFM) to observe real-time conformational changes upon ligand addition

  • Super-resolution microscopy combined with conformationally sensitive fluorescent probes

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides information about solvent accessibility changes upon ligand binding, revealing which regions of OR1A1 undergo structural rearrangements during activation. This technique is particularly valuable for mapping the transmembrane regions that change conformation upon binding ligands such as (-)-carvone .

The experimental approach should involve parallel studies using multiple techniques to build a comprehensive model of OR1A1 activation mechanics, with special attention to the structural changes that trigger G protein coupling and subsequent cAMP elevation .

How can researchers design OR1A1 mutants to probe structure-function relationships using VLP systems?

Strategic mutant design allows researchers to systematically investigate OR1A1 structure-function relationships:

Ligand binding pocket mapping:

  • Alanine scanning mutagenesis of predicted binding pocket residues

  • Conservative substitutions (e.g., Phe to Tyr) to probe specific chemical interactions

  • Creation of binding pocket size variants to determine spatial requirements for different ligands

Each mutant should be characterized for:

  • Expression level and incorporation efficiency into VLPs

  • Baseline activity in the absence of ligand

  • Dose-response relationships with reference ligands like (-)-carvone

  • Activation of downstream signaling measured by cAMP accumulation

G protein coupling interface investigation:

  • Mutations in intracellular loops, particularly IC3

  • C-terminal modifications to probe G protein selectivity

  • Creation of constitutively active mutants to study ligand-independent signaling

Transmission switch identification:

  • Mutations in conserved motifs thought to participate in activation

  • Engineering of disulfide bridges to restrict conformational changes

  • Introduction of fluorescent amino acids at key positions for spectroscopic monitoring

Data from these mutants should be integrated to develop a comprehensive model of:

  • How OR1A1 specifically recognizes ligands with relatively simple structures

  • The conformational changes that occur upon ligand binding

  • How these changes trigger the PKA-CREB-HES-1 signaling pathway observed in hepatocytes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.