Recombinant Human Olfactory receptor 1A1 (OR1A1)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

OR1A1 has been expressed in two primary systems:

HEK293S Cell Line

  • Method: Tetracycline-inducible stable expression with epitope tags .

  • Yield: ~2.7 mg total protein from 60 T175 flasks .

  • Functional Assays: Real-time cAMP measurements confirm receptor activity .

Transgenic Mouse Models

  • Advantages:

    • 40–100x higher sensitivity compared to heterologous systems .

    • Enables ex vivo cilia isolation for ligand profiling .

  • Example: 9x21-OR1A1-GCaMP6f mice show robust responses to ligands like MND (EC₅₀ = 388 nM) .

Ligand Binding Profile

OR1A1 is broadly tuned, responding to citrus/fruity odorants with varying affinities:

LigandAffinity/ResponseSource
DihydrojasmoneMicromolar range (intrinsic fluorescence) PubMed
MND (3-methyl-2,4-nonanedione)EC₅₀ = 0.29 µM (transgenic mice) bioRxiv
(–)-Carvone6.1x weaker than MND bioRxiv
(+)-CarvoneLower activation compared to (–)-enantiomer bioRxiv
CitronellalStrong agonist Wikipedia

Functional and Mechanistic Insights

  • Signaling Pathway: OR1A1 activates cAMP-mediated transduction upon ligand binding .

  • Stereoselectivity: Distinguishes between enantiomers like (–)-carvone and (+)-carvone .

  • Ligand Interactions:

    • Simple, small molecules (e.g., MW ~140 Da) bind via non-covalent interactions .

    • No chemical modification of ligands occurs during binding .

Research Applications and Challenges

  • Structural Biology: Purified OR1A1 enables crystallographic and NMR studies to resolve activation mechanisms .

  • Drug Discovery: Serves as a model for olfactory GPCR pharmacology due to its broad ligand spectrum .

  • Limitations: Poor plasma membrane expression in heterologous systems complicates high-throughput screening .

Future Directions

  1. Cryo-EM Studies: To resolve full 3D structures of OR1A1-ligand complexes .

  2. In Vivo Functional Mapping: Expand transgenic models to study OR1A1’s roles beyond olfaction (e.g., tumor microenvironments) .

  3. Ligand Design: Leverage homology models to engineer odorants with tailored binding properties .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is Tris/PBS-based buffer containing 5%-50% glycerol.
Please note: If you have specific requirements for the glycerol content, kindly specify them in your order remarks.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific preference for the format, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
OR1A1; Olfactory receptor 1A1; Olfactory receptor 17-7; OR17-7; Olfactory receptor OR17-11
Datasheet & Coa
Please contact us to get it.
Expression Region
1-309aa
Mol. Weight
50.6kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Molecular mechanism of activation of human musk receptors OR5AN1 and OR1A1 by (R)-muscone and diverse other musk-smelling compounds. PMID: 29632183
  2. OR1A1 activation suppresses hepatic triglyceride metabolism by modulating HES-1, PPARG, and mtGPAT expression. PMID: 25817041
  3. Evolutionary conserved amino acid residues necessary for specific responsiveness of OR1A1 to odorants were identified. PMID: 17601748
Database Links

HGNC: 8179

KEGG: hsa:8383

STRING: 9606.ENSP00000305207

UniGene: Hs.532688

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Human Olfactory Receptor 1A1 (OR1A1) and what is its primary function in olfaction?

    Human Olfactory Receptor 1A1 (OR1A1) is a member of the G protein-coupled receptor (GPCR) superfamily and represents one of approximately 400 intact olfactory receptors in humans. It functions primarily as a chemosensor in the olfactory epithelium where it detects specific odorant molecules.

    OR1A1 is notable for its ability to respond to nitromusks and certain other odorants. Unlike some olfactory receptors that respond to both macrocyclic and nitromusk compounds (such as OR5AN1), OR1A1 demonstrates relatively narrower musk-related ligand tuning, responding prominently to selected nitromusks like musk ambrette and to a lesser degree to other nitromusks, but not to macrocyclic or polycyclic musks .

    Beyond olfaction, OR1A1 has been detected in multiple non-olfactory tissues, suggesting additional physiological roles outside of smell perception .

  • What structural characteristics define OR1A1?

    OR1A1 shares the characteristic seven-transmembrane α-helical structure common to G protein-coupled receptors. While the actual three-dimensional structure of OR1A1 has not yet been determined through crystallography, computational homology models have been developed based on other GPCRs.

    Key structural features of OR1A1 include:

    • Seven-transmembrane α-helical domains (TM1-TM7)

    • An odorant binding pocket formed primarily by helices 3, 5, 6, and 7

    • Critical binding residues including Tyr258 and Tyr251 in transmembrane α-helix 6 (TM6), Ile205 and Phe206 in transmembrane α-helix 5 (TM5), and Ile105 and Tyr113 in transmembrane α-helix 3 (TM3), and Leu184 in extracellular loop 2

    Homology modeling studies have shown that the binding site of OR1A1 is located near the extracellular loop (ECL2) of the receptor, which differs from the deep binding site proposed for smaller odorants in other olfactory receptors .

  • What are the confirmed ligands for OR1A1 and their relative binding affinities?

    OR1A1 has been shown to respond to several odorants with varying affinities:

    LigandRelative ResponseBinding Properties
    Musk ambretteHighForms hydrogen bonds with Tyr258; EC50 in micromolar range
    Musk tibeteneModerateForms hydrogen bonds with Tyr258
    Musk xyleneLowWeaker binding compared to other nitromusks
    DihydrojasmoneHighPrimary cognate odorant; affinity in micromolar range
    (-)-CarvoneModerate~3.5× lower response than dihydrojasmone
    (+)-CarvoneLow~6.1× lower response than (-)-carvone
    3-methyl-2,4-nonanedione (MND)Very HighBest ligand for OR1A1; EC50 ~388 nM in optimized expression systems

    The stereoselective response to carvone isomers indicates the importance of three-dimensional structure in ligand recognition .

  • How is OR1A1 signaling transduced within cells?

    OR1A1 primarily signals through the canonical G protein-coupled pathway in olfactory sensory neurons:

    1. Upon odorant binding, OR1A1 couples to the olfactory G protein alpha subunit (Gαolf)

    2. Activated Gαolf stimulates adenylyl cyclase type 3 (Adcy3/AC3)

    3. This increases intracellular cyclic adenosine monophosphate (cAMP) levels

    4. Elevated cAMP opens cyclic nucleotide-gated (CNG) channels, causing membrane depolarization

    5. This triggers action potentials that are transmitted to the brain

    In non-olfactory tissues, OR1A1 can activate alternative signaling pathways. For example, in hepatocytes, activation of the mouse homolog of OR1A1 (olfr43) stimulates the CREB-HES1-PPAR-γ signaling axis .

    The signaling components (Gαolf, Adcy3, etc.) are primarily localized to the cilia of olfactory neurons, making this compartment sufficient for converting odorant binding to cAMP production in isolated preparations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.