Recombinant Human Olfactory receptor 1D4 (OR1D4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OR1D4; Olfactory receptor 1D4; Olfactory receptor 17-30; OR17-30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR1D4
Target Protein Sequence
MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCD MYILLWLACSNTHIIHTALIATGCFIFLTLLGFMTTSYVRIVRTILQMPSASKKYKTFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYSLRNKDMHGAP GRVLWRPFQRP
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8185

UniGene: Hs.653087

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR1D4 and what is its role in olfactory perception?

OR1D4 (Olfactory Receptor Family 1 Subfamily D Member 4) is a protein encoded by the OR1D4 gene in humans. It belongs to the large family of G-protein-coupled receptors (GPCRs) that are responsible for olfactory perception. OR1D4 contains a 7-transmembrane domain structure common to many neurotransmitter and hormone receptors . This olfactory receptor interacts with odorant molecules in the nasal cavity, initiating a neuronal response that triggers the perception of specific smells . Like other olfactory receptors, OR1D4 arises from a single coding-exon gene and participates in the G protein-mediated transduction of odorant signals .

How is OR1D4 related to other members of the OR1D subfamily?

OR1D4 is one of three full-length olfactory receptors in the OR1D subfamily present in the human genome, alongside OR1D2 and OR1D5 . These receptors share more than 80% DNA sequence identity, with approximately 108 base pair mismatches among them . While these mismatches do not show obvious patterns using standard computer recognition tools, researchers have found that mathematical principles based on L-system generated sequences can be used to model the relationships between these subfamily members . The high sequence similarity suggests functional relationships, though each receptor may have distinct odorant specificities. OR1D2, another member of this subfamily, is known to bind Bourgeonal, a volatile component of lily of the valley fragrance .

What are the structural characteristics of OR1D4?

OR1D4, like other olfactory receptors, is primarily characterized by an α-helical structure with seven transmembrane domains typical of G-protein-coupled receptors . Secondary structure analysis using circular dichroism (CD) spectroscopy of purified olfactory receptors shows typical α-helical features, consistent with the predicted structure . The ligand-binding pocket is believed to be buried within the protein structure, which presents challenges for measuring odorant binding through traditional methods . The protein contains both N-terminal and C-terminal regions extending from the transmembrane core, with the C-terminal domain often used for tagging purposes in experimental settings (such as with histidine or Rho tags for purification) .

What methodologies are most effective for producing recombinant OR1D4?

Cell-free production systems have proven highly effective for synthesizing recombinant olfactory receptors, including OR1D4. The wheat germ extract system has been successfully employed for human olfactory receptor production . This approach offers several advantages:

  • High yield: approximately 0.3 mg of pure receptor per milliliter of cell-free reaction solution can be achieved

  • Simplified purification: using 1D4 antibody-coated Sepharose-4B beads specific for a Rho tag (TETSQVAPA) enables highly specific purification

  • Proper folding: receptors produced using this method display typical α-helical features when analyzed by circular dichroism, suggesting correct folding

The production protocol typically involves:

  • PCR-based gene synthesis with codon optimization

  • Template generation with appropriate tags (histidine or Rho) for purification

  • Cell-free expression using wheat germ extract

  • Affinity purification using antibody-coated beads

  • Size exclusion chromatography for final purification

This approach yields sufficient quantities of properly folded receptor for structural studies and functional assays.

How can researchers assess the functional activity of purified OR1D4?

Assessing the functional activity of solubilized olfactory receptors presents unique challenges due to the small size of odorant molecules (typically <300 Da) compared to the receptor (approximately 36,000 Da) . Surface Plasmon Resonance (SPR) technology, such as Biacore, offers a sensitive, label-free method for detecting these interactions:

  • The receptor is captured on a sensor chip surface

  • Various concentrations of potential ligands are flowed over the surface

  • Binding events cause measurable changes in mass at the surface

  • Binding kinetics and affinity constants can be derived from the data

For related olfactory receptors, this approach has successfully demonstrated dose-dependent binding of ligands with affinity constants (KD) in the micromolar range (approximately 22 μM for hOR17-4) . Similar methodologies can be applied to OR1D4 to identify potential ligands and characterize binding properties.

What is known about the odorant specificity and ligand binding properties of OR1D4?

While detailed ligand specificity for OR1D4 has not been fully characterized in the provided research, network analysis of olfactory receptor-odor associations suggests that OR1D4, along with OR1D3, OR1D5, and OR1D6, is associated with the "muguet" (lily of the valley) floral odor . This association is particularly interesting given that the related receptor OR1D2 binds Bourgeonal, a chemical component of lily of the valley fragrance .

Global mapping studies of odorant-receptor interactions provide a network-based approach to predicting OR-odor associations:

OdorAssociated ORsConfidence Score
muguetOR1D3, OR1D4, OR1D5, OR1D6Not specified

What are the key considerations for designing experiments to study OR1D4-ligand interactions?

When designing experiments to study OR1D4-ligand interactions, researchers should consider:

  • Receptor production and stability:

    • Use a cell-free system with wheat germ extract for high-yield production

    • Include stabilizing agents in purification buffers, such as reducing agents like TCEP (tris(2-carboxyethyl)phosphine), which has been shown to improve purity and stability of related olfactory receptors

    • Consider using a combination of affinity purification (e.g., with 1D4 antibody for Rho-tagged receptors) and size exclusion chromatography

  • Ligand selection:

    • Include molecules with the "muguet" (lily of the valley) note, as OR1D subfamily members have been associated with this odor

    • Test compounds structurally similar to Bourgeonal, which binds to the related receptor OR1D2

    • Design a concentration series (typically in the micromolar range) to establish dose-response relationships

  • Binding assay methodology:

    • Surface Plasmon Resonance (SPR) has proven effective for detecting odorant binding to olfactory receptors

    • Ensure homogeneous solution behavior of odorants to obtain reliable binding data

    • Include appropriate controls (non-binding odorants, buffer controls) in experimental design

  • Data analysis:

    • Use appropriate curve-fitting models to derive binding constants (KD) from SPR data

    • Consider the impact of detergents and buffer components on binding measurements

What approaches can be used to overcome challenges in structural studies of OR1D4?

Structural studies of olfactory receptors, including OR1D4, face significant challenges due to their membrane protein nature. Based on successful approaches with related receptors, researchers might consider:

  • Optimizing purification conditions:

    • Test different detergents and lipid compositions to maintain receptor stability

    • Include reducing agents like TCEP in purification buffers, which has been shown to improve purity and yield

    • Concentrate purified receptor to >5 mg/ml for crystallization studies using tools like Amicon Ultra-4 Centrifugal Filters

  • Secondary structure validation:

    • Use circular dichroism (CD) spectroscopy to confirm proper α-helical folding before attempting crystallization

    • Compare mean residue ellipticity profiles with and without reducing agents to assess structural integrity

  • Alternative structural approaches:

    • Consider cryo-electron microscopy as an alternative to crystallization

    • Explore computational modeling based on the known structures of other GPCRs

    • Use NMR for structural studies of specific domains or ligand interactions

  • Stabilizing strategies:

    • Employ fusion protein approaches or antibody fragments to stabilize flexible regions

    • Explore directed evolution methods to identify stabilizing mutations

    • Consider the use of nanobodies or other crystallization chaperones

How can computational approaches enhance the study of OR1D subfamily receptors?

Computational methods offer powerful tools for studying the OR1D subfamily when combined with experimental data:

  • Sequence analysis and modeling:

    • Mathematical principles, such as L-system generated sequences, can model relationships between OR1D subfamily members (OR1D2, OR1D4, OR1D5)

    • These models can potentially predict novel subfamily members with specific functional properties

    • The existing 108 base pair mismatches between subfamily members can be analyzed to understand the evolutionary relationships and functional divergence

  • Network-based analyses:

    • Network approaches can predict associations between ORs and specific odors

    • For odor-OR associations, confidence scores can be calculated based on the formula:
      AS = A/(C×D) where A is the number of compounds with a given odor note activating a given OR, C is the total number of ORs activated by compounds with this odor note, and D is the total number of compounds with this odor note

    • This approach can guide experimental testing of potential OR1D4 ligands

  • Structure prediction:

    • Homology modeling based on available GPCR structures

    • Molecular dynamics simulations to predict ligand binding interactions

    • Docking studies to screen potential odorants in silico before experimental validation

What are the best practices for analyzing OR1D4 binding data?

When analyzing binding data for OR1D4-odorant interactions:

  • SPR data analysis:

    • Apply appropriate kinetic models (1:1 binding, heterogeneous ligand, etc.)

    • Calculate association (ka) and dissociation (kd) rate constants

    • Determine equilibrium dissociation constants (KD) from steady-state analysis

    • Compare with EC50 values from cellular assays when available

  • Data quality assessment:

    • Evaluate signal-to-noise ratios in sensorgrams

    • Assess reproducibility across multiple independent experiments

    • Consider the impact of non-specific binding and mass transport limitations

    • Validate with orthogonal binding assay methods when possible

  • Comparative analysis:

    • Compare binding properties across OR1D subfamily members (OR1D2, OR1D4, OR1D5)

    • Correlate binding affinities with structural features of odorants

    • Integrate with sensory perception data when available

What are the major challenges in OR1D4 research and potential solutions?

Research on OR1D4 faces several challenges that require innovative approaches:

  • Production challenges:

    • Membrane protein expression and stability issues

    • Solution: Cell-free production systems using wheat germ extract have shown promise with yields of ~0.3 mg/ml

    • Further optimization of buffer conditions, particularly the inclusion of reducing agents like TCEP, can improve purity and stability

  • Functional characterization:

    • Difficulty in establishing robust functional assays for olfactory receptors

    • Solution: Surface Plasmon Resonance (Biacore) provides a label-free approach to measure odorant binding directly

    • Integration with cellular response assays could provide complementary functional data

  • Structural determination:

    • Challenges in crystallizing membrane proteins

    • Solution: Pursue alternative structural biology approaches such as cryo-EM

    • Use computational modeling based on existing GPCR structures as an interim approach

  • Physiological relevance:

    • Connecting molecular interactions to sensory perception

    • Solution: Integrate findings from molecular studies with sensory evaluation data

    • Collaborate with sensory scientists to correlate molecular binding with odor perception

What emerging technologies might advance OR1D4 research?

Several emerging technologies show promise for advancing OR1D4 research:

  • Advanced cell-free expression systems:

    • Continuous exchange cell-free systems for higher yields

    • Incorporation of nanodiscs or lipid bilayers during cell-free expression

  • Single-molecule techniques:

    • FRET-based approaches to study conformational changes upon ligand binding

    • Single-molecule force spectroscopy to characterize ligand binding energetics

  • Artificial intelligence applications:

    • Machine learning for predicting OR-odorant interactions based on existing data

    • Deep learning approaches to model complex relationships between receptor sequence and function

  • Gene editing technologies:

    • CRISPR-Cas9 for creating cellular models with specific OR1D4 variants

    • Base editing for precise modification of key residues to study structure-function relationships

  • Synthetic biology approaches:

    • Creation of artificial receptor arrays with defined OR1D4 expression

    • Development of biosensors based on OR1D4 for detecting specific odorants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.