Recombinant Human Olfactory receptor 1E3 (OR1E3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Olfactory Receptor 1E3 (OR1E3)

Recombinant Human Olfactory Receptor 1E3 (OR1E3) is a synthetic protein derived from the OR1E3 gene, a member of the olfactory receptor (OR) family. ORs are G-protein-coupled receptors (GPCRs) primarily involved in odor detection, though their roles extend to other physiological processes, including sperm chemotaxis and cellular signaling . OR1E3 belongs to subfamily E of class II (tetrapod-specific) olfactory receptors, which typically detect hydrophobic odorants .

Challenges in Functional Characterization

  • Pseudogene Limitation: The Leu-17 deletion disrupts proper folding, complicating functional assays .

  • Ligand Deorphanization: No confirmed odorants bind OR1E3; related ORs (e.g., OR2W3) respond to nerol and methional .

Comparative Analysis of OR1E3 with Other ORs

FeatureOR1E3OR2W3OR10J1
LigandsUnknownNerolDimetol
ExpressionPseudogene (human)Sperm midpiece Sperm flagella
SubfamilyClass II (E)Class IIClass II

Current Research Gaps and Future Directions

  1. Functional Rescue: Engineering OR1E3 to restore Leu-17 for ligand-screening studies.

  2. Cross-Species Comparisons: Investigating OR1E3’s role in non-human mammals (e.g., mice).

  3. Non-Olfactory Roles: Exploring involvement in immune or neurodegenerative pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR1E3; OR1E3P; Olfactory receptor 1E3; Olfactory receptor 17-210; OR17-210; Olfactory receptor OR17-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR1E3
Target Protein Sequence
MMKKNQTMISEFLLLGLPIQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPMY LCLSNLSFSDLCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMAY HCYVAICFPLHYTTIMSPKCCLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFCD TSTLLKLACSNTQVNGWVMFFMGGLILVIPFLLLIMSCARIVSTILRVPSTGGIQKAFST CGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTGVTHMLNPFIYSLRNRDMRGN PGQSLQHKENFFVFKIVIVGILPLLNLVGVVKLIMKYHSKSVA
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8191

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory Receptor 1E3 and what is its significance in olfactory research?

Human Olfactory Receptor 1E3 (OR1E3) is a member of the olfactory receptor family located on chromosome 17. It belongs to the largest gene superfamily in the human genome - the olfactory receptor gene family. OR1E3 has particular significance in olfaction research as it has been suggestively associated with the perception of specific odorants, notably cinnamon, according to genetic association studies .

Olfactory receptors function in a combinatorial manner, meaning a single OR can recognize multiple odorants, while a single odorant may stimulate several discrete types of ORs . This combinatorial coding is fundamental to how humans distinguish thousands of different odors with a limited number of receptor types. OR1E3 represents an important component in this complex system, making it valuable for understanding the molecular basis of odor perception.

What expression systems are most effective for functional studies of recombinant olfactory receptors like OR1E3?

Based on successful expression of other human olfactory receptors, two primary expression systems have proven effective for recombinant olfactory receptor studies:

  • HEK293 Cell Expression System: Human Embryonic Kidney 293 (HEK293) cells have been successfully used to functionally express human olfactory receptor proteins . This mammalian cell line provides an appropriate cellular environment with necessary signaling components. For olfactory receptors, stable or transient transfection with receptor-encoding plasmids (similar to pOR17-40 described in literature) allows functional expression in the plasma membrane .

  • Xenopus laevis Oocyte Expression System: This system has also demonstrated success with olfactory receptor expression. Following microinjection of receptor cRNA into oocytes, functional expression can be achieved. This system is particularly valuable when co-expressing "reporter" channels that allow measurement of receptor responses to odorant stimulation .

These heterologous expression systems provide platforms for characterizing OR1E3's ligand specificity, activation mechanisms, and structure-function relationships in controlled laboratory conditions.

What are the standard detection methods for measuring recombinant OR1E3 activation?

Two primary methodological approaches are standard for measuring activation of recombinant olfactory receptors including OR1E3:

  • Calcium Imaging in HEK293 Cells: This method detects transient increases in intracellular calcium concentration ([Ca²⁺]) following receptor activation. When expressed in HEK293 cells, olfactory receptors like OR1E3 can be coupled to calcium signaling pathways, either through endogenous G proteins or through co-expressed chimeric G proteins. Upon odorant binding, the activated receptor triggers a signaling cascade leading to calcium release, which can be measured using calcium-sensitive fluorescent dyes and appropriate imaging systems .

  • Electrophysiological Measurements in Xenopus Oocytes: In the oocyte system, olfactory receptor activation can be measured through electrophysiological recordings. This typically involves co-expression of the receptor with a "reporter" channel whose conductance changes in response to second messengers generated upon receptor activation. Conductance changes can be measured as either the slope of current signals in response to voltage ramps (e.g., from -50 to +50 mV) or the amplitude of currents induced by voltage steps .

These methodological approaches provide complementary data on receptor function, with calcium imaging offering higher throughput and electrophysiology providing more detailed kinetic information.

How should odorant stimuli be prepared and delivered for OR1E3 functional studies?

Proper preparation and delivery of odorant stimuli are critical for reproducible results in OR1E3 functional studies:

  • Stock Solution Preparation:

    • Prepare concentrated stock solutions of test odorants in dimethyl sulfoxide (DMSO) or ethanol.

    • Maintain stocks at -20°C in sealed, amber glass vials to prevent degradation.

    • Document the source, purity, and storage conditions of all odorants.

  • Working Solution Preparation:

    • Dilute stock solutions to working concentrations in appropriate buffers immediately before experiments.

    • For HEK293 cell experiments, prepare odorants in Ringer's solution or appropriate cell culture medium.

    • For oocyte experiments, dilute odorants in standard oocyte Ringer's solution to the desired test concentration .

    • Maintain final solvent concentration below 0.1% to avoid non-specific effects.

  • Stimulus Delivery Systems:

    • For HEK293 imaging: Use gravity-fed perfusion systems or automated pipetting for solution application.

    • For oocyte recordings: Employ multibarrel single-tip superfusion devices for precise odorant delivery .

    • Include appropriate controls (vehicle alone, known agonists) in each experimental session.

Systematic preparation and delivery methods ensure that observed responses can be reliably attributed to specific odorant-receptor interactions.

What experimental design approaches are optimal for OR1E3 ligand discovery and validation?

Optimal experimental design for OR1E3 ligand discovery should follow a systematic approach that progresses from broad screening to specific validation:

  • Initial Screening Phase:

    • Begin with a diverse odorant mixture (similar to the Henkel 100 mixture used in literature) .

    • Test at multiple concentrations to construct dose-response relationships.

    • Include positive controls (if available) and negative controls.

  • Progressive Deconvolution:

    • If activity is detected with a mixture, subdivide into smaller groups to identify active components.

    • Continue this "divide and conquer" approach until individual active compounds are identified .

  • Structure-Activity Relationship Analysis:

    • Test structurally related compounds to the identified hits (as performed with helional and heliotropylyacetone in the case of OR17-40) .

    • Determine the minimal structural requirements for receptor activation.

  • Experimental Design Framework:

    Design PhaseKey ComponentsMeasurement Parameters
    ScreeningDiverse odor mixturesResponse magnitude, EC50
    DeconvolutionSystematic subdivisionBinary (active/inactive)
    SAR AnalysisStructural analogsPotency, efficacy, kinetics
    ValidationReplication, controlsStatistical significance
  • Statistical Validation:

    • Follow rigorous statistical protocols to minimize false positives and negatives.

    • Define clear objectives before beginning experiments .

    • Select appropriate response measurements and ensure the measurement system is accurate, repeatable, and stable .

    • Execute experiments with precision to minimize variability .

This systematic approach maximizes the chances of identifying true ligands while minimizing resources expended on false leads.

How should researchers address data that contradicts expected OR1E3 activation patterns?

When encountering contradictory data in OR1E3 research, a systematic troubleshooting approach is essential:

  • Data Examination Process:

    • Thoroughly examine findings by identifying discrepancies between expected and observed results .

    • Pay particular attention to outliers that may have influenced the results .

    • Compare the data with existing literature on OR1E3 and related olfactory receptors.

  • Methodological Verification:

    • Verify expression of the receptor using techniques such as immunostaining, Western blotting, or reporter tags.

    • Confirm functional coupling of the receptor to downstream signaling components.

    • Check for potential contamination of odorant solutions or degradation of test compounds.

    • Verify cell health and assay performance using positive controls.

  • Alternative Hypotheses Consideration:

    • Consider whether the receptor might be responding to contaminants rather than the intended test compound.

    • Evaluate whether the observed response could be receptor-independent.

    • Assess whether the experimental conditions (pH, temperature, ionic concentrations) might be affecting receptor function.

  • Revised Experimental Approach:

    Issue IdentifiedTroubleshooting ApproachExpected Outcome
    Insufficient expressionOptimize expression system/conditionsIncreased signal-to-noise ratio
    Non-specific responsesInclude appropriate controlsDifferentiation between specific/non-specific effects
    Inconsistent odorant deliveryStandardize preparation protocolsImproved reproducibility
    Signal detection limitationsModify detection methodEnhanced sensitivity
  • Documentation and Reporting:

    • Document all unexpected findings thoroughly.

    • Report contradictory results, as these may provide valuable insights into receptor function or experimental limitations .

By approaching contradictory data as an opportunity for deeper investigation rather than a failure, researchers can gain new insights into OR1E3 function and refine experimental methodologies.

What genomic approaches are available for studying OR1E3 variation and its influence on olfactory perception?

Several genomic approaches have been developed to investigate olfactory receptor variation and its functional consequences:

  • Genome-Wide Association Studies (GWAS):

    • Large-scale studies can identify associations between OR1E3 genetic variants and specific odor identification abilities.

    • Studies have already identified suggestive associations between OR1E3 variants and cinnamon odor perception .

    • GWAS approaches require careful phenotyping using standardized olfactory tests such as the Brief Smell Identification Test (BSIT) .

  • Targeted Sequencing Approaches:

    • Focused sequencing of OR1E3 and related olfactory receptor genes allows identification of rare variants.

    • Both coding and regulatory regions should be examined for comprehensive assessment.

    • Next-generation sequencing technologies enable efficient screening of the entire OR gene family.

  • Functional Characterization of Variants:

    • Recombinant expression of OR1E3 variants identified in population studies.

    • Comparison of functional properties (ligand specificity, sensitivity, signal transduction efficiency).

    • Correlation of in vitro functional differences with in vivo perception phenotypes.

  • Statistical Analysis Approaches:

    Analysis MethodApplicationOutcome Measures
    Single-variant analysisIndividual SNP associationsp-values, odds ratios
    Gene-based testsCumulative effect of variantsGene-level significance
    Polygenic risk scoresCombined genetic factorsCorrelation with phenotype
    Pathway analysisOR gene family interactionsEnrichment statistics
  • Integration with Other Datasets:

    • Combine genetic data with functional MRI or other imaging studies.

    • Incorporate health variables that might influence olfaction.

    • Consider polygenic risk scores for conditions known to affect olfaction, such as neurodegenerative diseases .

These genomic approaches provide complementary information on how OR1E3 variation contributes to individual differences in odor perception.

How does aging affect OR1E3 function and expression, and what methodological considerations should researchers address?

Research indicates that olfactory function generally declines with age, with multiple potential mechanisms affecting olfactory receptor function, including OR1E3:

Understanding the impact of aging on OR1E3 function has implications for both basic olfactory research and clinical applications in age-related olfactory dysfunction.

What are the current approaches for studying structure-activity relationships (SAR) of OR1E3 ligands?

Structure-activity relationship studies for OR1E3 ligands require systematic approaches to correlate molecular features with receptor activation:

  • Ligand-Based SAR Approaches:

    • Once active compounds are identified, systematic modification of their structural elements helps determine essential features.

    • This approach was successfully applied with other olfactory receptors, where compounds like helional and structurally related heliotropylyacetone were found to activate OR17-40, while similar compounds like piperonal, safrole, and vanillin were ineffective .

    • For OR1E3, compounds associated with cinnamon odor perception would be logical starting points for SAR studies .

  • Pharmacophore Modeling:

    • Computational approaches to identify common features among active compounds.

    • Generation of 3D pharmacophore hypotheses to predict new potential ligands.

    • Virtual screening of compound libraries based on pharmacophore models.

  • Computational Docking Studies:

    • Homology models of OR1E3 based on available GPCR crystal structures.

    • Docking simulations to predict binding modes of known ligands.

    • Virtual mutations to test hypotheses about ligand-receptor interactions.

  • Systematic Testing Framework:

    ApproachMethodologyOutput
    Functional Group AnalysisSequential modification of active compoundsEssential chemical features
    Stereochemistry AnalysisTesting of stereoisomersStereo-selectivity profile
    Fragment-Based AnalysisTesting of molecular fragmentsMinimal pharmacophore
    Bioisostere TestingReplacement with equivalent groupsTolerance for substitution
  • Quantitative Structure-Activity Relationship (QSAR):

    • Collection of activity data for a series of compounds.

    • Calculation of molecular descriptors (physicochemical properties, topological indices).

    • Statistical modeling to correlate structure with activity.

    • Validation of models using test compounds.

These SAR approaches provide valuable insights into the molecular recognition properties of OR1E3 and guide the development of more potent and selective ligands for research purposes.

What methods are available for integrating OR1E3 research findings with broader olfactory perception studies?

Integrating molecular findings about OR1E3 with broader olfactory perception requires multidisciplinary approaches:

  • Translational Research Framework:

    • Connect in vitro receptor characterization with in vivo perceptual studies.

    • Correlate genetic variation in OR1E3 with perceptual differences using standardized olfactory tests.

    • Validate findings across multiple populations and age groups.

  • Cross-Disciplinary Methodologies:

    Research DomainIntegration ApproachOutcome Measures
    Molecular BiologyFunctional expression of OR1E3 variantsReceptor activation profiles
    GeneticsGenotyping of OR1E3 in test populationsGenotype-phenotype correlations
    PsychophysicsThreshold/discrimination/identification testsPerceptual parameters
    NeurosciencefMRI/EEG during odor exposureCentral processing patterns
  • Phenotyping Approaches:

    • Standardized olfactory tests such as the Brief Smell Identification Test (BSIT) provide reliable measurements .

    • Specific odor identification tests focusing on cinnamon and related compounds relevant to OR1E3 .

    • Threshold tests to determine sensitivity differences associated with OR1E3 variants.

    • Mixture studies to examine combinatorial effects with other olfactory receptors.

  • Data Integration Strategies:

    • Machine learning approaches to identify patterns across molecular, genetic, and perceptual datasets.

    • Network analysis of olfactory receptor interactions and perceptual relationships.

    • Development of comprehensive databases linking receptor function to perceptual outcomes.

  • Clinical Applications:

    • Connection between OR1E3 function and olfactory disorders.

    • Development of targeted olfactory tests based on OR1E3 ligands.

    • Potential diagnostic applications for conditions associated with olfactory dysfunction.

These integrative approaches allow researchers to bridge the gap between molecular mechanisms and perceptual experiences, providing a more complete understanding of how OR1E3 contributes to human olfaction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.