Recombinant Human Olfactory receptor 1F12 (OR1F12)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

OR1F12 is challenging to express functionally in standard systems like HEK293 due to low basal activity and trafficking issues . Key steps in its recombinant production include:

  1. Vector Design: Cloning into plasmids (e.g., pME18S) with epitope tags (FLAG/Rho) for immunoaffinity purification .

  2. Cell Line: Use of specialized cell lines (e.g., LNCaP) for improved expression of ORs with high basal activity .

  3. Purification: Detergent solubilization followed by anti-FLAG chromatography and gel filtration .

Known Ligands and Functional Data

No ligands for OR1F12 have been experimentally validated in the provided sources. By contrast, other ORs like OR1D2 (bourgeonal) or OR51E1 (nonanoic acid) have well-characterized agonists. OR1F12’s ligand profile remains uncharacterized, highlighting a gap in olfactory receptor deorphanization efforts .

Research Challenges and Future Directions

  • Functional Assays: OR1F12’s high basal activity complicates ligand screening, necessitating advanced systems like calcium imaging or cAMP real-time assays .

  • Antisense Transcripts: RNA-Seq data suggest antisense OR transcripts may regulate OR1F12 expression in spermatozoa, though their role is unclear .

  • Potential Applications: Development of biosensors for odorant detection, akin to OR2W1- or OR1A2-based systems .

References

  1. OR1D2 ligand data (Bourgeonal)

  2. Olfactory receptor family overview

  3. Purification methods for ORs

  4. Functional expression challenges

  5. LNCaP cell line for OR assays

  6. OR1F12 recombinant protein specifications

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
OR1F12; OR1F12P; Olfactory receptor 1F12; Hs6M1-35P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR1F12
Target Protein Sequence
MEGKNQTNISEFLLLGFSSWQQQQVLLFALFLCLYLTGLFGNLLILLAIGSDHCLHTPMY FFLANLSLVDLCLPSATVPKMLLNIQTQTQTISYPGCLAQMYFCMMFANMDNFLLTVMAY DRYVAICHPLHYSTIMALRLCASLVAAPWVIAILNPLLHTLMMAHLHFCSDNVIHHFFCD INSLLPLSCSDTSLNQLSVLATVGLIFVVPSVCILVSYILIVSAVMKVPSAQGKLKAFST CGSHLALVILFYGAITGVYMSPLSNHSTEKDSAASVIFMVVAPVLNPFIYSLRNNELKGT LKKTLSRPGAVAHACNPSTLGGRGGWIMRSGDRDHPG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 13964

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR1F12 and what is its primary function?

OR1F12 (Olfactory Receptor Family 1 Subfamily F Member 12) is a G-protein coupled receptor (GPCR) that belongs to the human olfactory receptor gene family. Its primary function involves interacting with odorant molecules in the nose, initiating a neuronal response that triggers the perception of smell . Like most olfactory receptors, OR1F12 likely exhibits specificity for certain odorant molecules, though its specific ligands have not been fully characterized based on the available search results. This places OR1F12 among the majority of human olfactory receptors that remain "orphaned" (without known ligands), as more than 80% of the human olfactory receptor repertoire remains functionally uncharacterized .

Understanding the specific odorant binding profile of OR1F12 would enhance our knowledge of the relationship between receptor function and olfactory perception. The receptor belongs to a complex gene family that has evolved through processes of gene duplication and divergence, with most subfamilies encoded by genes at a single chromosomal locus .

How does OR1F12 fit into the broader olfactory receptor gene family?

The human olfactory receptor gene family is organized into subfamilies based on sequence similarity, with most subfamilies encoded by genes at a single chromosomal locus. According to research, 79% of subfamilies with more than one member are encoded by genes at one locus, with an additional 8% encoded by genes at adjacent loci . This organization highlights the important role of local gene duplication and divergence in the evolution of the OR gene family.

Different chromosomal loci encode different subfamilies of ORs and might therefore be involved in the perception of different odors . While the specific subfamily characteristics of OR1F12 are not detailed in the search results, its designation as part of Family 1, Subfamily F indicates its placement within this hierarchical classification system. This organization is significant as it provides insights into both the evolutionary history and potential functional relationships between olfactory receptors.

Where is OR1F12 typically expressed beyond the olfactory epithelium?

While OR1F12 is primarily associated with olfactory epithelium in the nose, research has revealed that olfactory receptors are often expressed in various tissues throughout the body, where they play critical physiological roles beyond smell perception . The search results don't specifically detail the expression pattern of OR1F12 across different tissues, but the broader context suggests that like other olfactory receptors, it may have extranasal functions.

This extranasal expression of olfactory receptors has become an important area of research, expanding our understanding of their diverse physiological roles. For researchers investigating OR1F12, considering potential expression and function in non-olfactory tissues may provide valuable insights into its broader biological significance beyond its role in olfaction.

What cell lines are most effective for the functional expression of OR1F12?

The functional expression of olfactory receptors, including OR1F12, presents a significant challenge in research. While HEK293 cells are the most commonly used heterologous expression system for determining olfactory receptor function, they cannot functionally express a majority of ORs, likely due to a lack of factors required in cells where ORs function endogenously .

For OR1F12 specifically, research indicates it was among 34 receptors tested during later screening via construction of expression vectors . Studies have demonstrated that certain cell lines may be more effective for expressing specific ORs, particularly those with high basal activity. For instance, the human prostate carcinoma (LNCaP) cell line has successfully identified novel ligands for ORs that were not recognized when expressed in HEK293 cells .

Based on available research, multiple cell lines should be considered for OR1F12 expression:

Cell LineAdvantagesRecommended Transfection Reagent
HEK293Standard system; widely usedPEI-MAX (0.1%, pH 7.5)
LNCaPEffective for ORs with high basal activityLipofectamine 3000
HepG2Alternative system for testingLipofectamine 2000
HuH7Alternative system for testingLipofectamine 2000

This comparative approach allows researchers to identify the optimal cellular environment for functional expression of OR1F12, potentially overcoming limitations associated with traditional expression systems .

What are the key components needed for transfection experiments with OR1F12?

Successful transfection experiments with OR1F12 require several key components and carefully optimized conditions. Based on established protocols, the following components are essential for a standard 384-well plate assay :

  • FLAG-Rho-tagged OR pME18S vector containing the OR1F12 gene (0.029 μg per well)

  • CRE/luc2PpGL4.29 (CRE-dependent firefly luciferase) (0.022 μg per well for HEK293; 0.011 μg per well for other cell lines)

  • pRL-CMV (constitutively expressed Renilla luciferase) (0.0011 μg per well)

  • RTP1S pME18S vector (0.012 μg per well)

  • Gαolf pME18S vector (0.010 μg per well, for cell lines other than HEK293)

The human RTP1S (Receptor Transporting Protein 1 Short) gene is particularly important as it enhances the functional expression of ORs in heterologous systems. This protein is typically amplified from human genomic DNA and inserted into expression vectors without any N-terminal epitope tag .

The inclusion of Gαolf depends on the cell line used. Research has shown that Gαolf does not improve detection of OR-mediated cAMP response in HEK293 cells but enhances detection in other cell types . This cell-specific requirement highlights the importance of tailoring transfection protocols to the specific cellular environment being used for OR1F12 expression.

How should control experiments be designed when working with OR1F12?

When designing experiments with OR1F12, proper controls are essential for reliable interpretation of results. A comprehensive control strategy should include:

  • Negative Controls:

    • Transfection with empty vector (pME18S without OR1F12)

    • Vehicle control (solvent without odorant)

    • Non-transfected cells to assess background cellular responses

  • Positive Controls:

    • A well-characterized OR with known ligands

    • M3AchR (muscarinic acetylcholine receptor) which has been used as a control in OR expression systems

  • Normalization Controls:

    • Dual luciferase reporter system with constitutively expressed Renilla luciferase (pRL-CMV) to normalize for transfection efficiency and cell number variations

  • Technical Controls:

    • Multiple replicates (at least three trials) for each experimental condition

    • Testing multiple concentrations of potential ligands to establish dose-response relationships

For a 96-well plate assay screening OR1F12 against potential ligands, a standardized approach includes transfecting cells with 0.075 μg of FLAG-Rho-tagged OR1F12 pME18S vector, 0.03 μg of CRE-dependent luciferase, 0.03 μg of pRL-CMV, and 0.03 μg of RTP1S pME18S vector per well . This configuration provides a balanced system for detecting OR activation while controlling for experimental variables.

How does the basal activity of OR1F12 affect experimental outcomes?

The basal activity of olfactory receptors can significantly impact experimental outcomes and complicate data interpretation. High basal activity, which refers to the receptor's constitutive signaling in the absence of ligand binding, can mask or impede the detection of ligand-mediated responses . This is a critical consideration when working with OR1F12, as elevated baseline signaling can reduce the signal-to-noise ratio in functional assays.

According to research findings, the LNCaP cell line has demonstrated effectiveness for the functional expression of ORs with high basal activity . This suggests that for OR1F12, if it exhibits high constitutive activity, traditional HEK293 expression systems might be suboptimal for deorphanization studies and ligand identification.

Strategies to address high basal activity issues include:

  • Using cell lines like LNCaP that better accommodate high basal activity ORs

  • Implementing robust normalization controls to account for baseline variations

  • Developing more sensitive detection methods with improved dynamic range

  • Considering experimental designs that allow for the detection of both agonism and inverse agonism

The challenge of high basal activity underscores the importance of selecting appropriate experimental systems when working with potentially constitutively active receptors like OR1F12 .

What are the primary challenges in deorphanizing OR1F12?

Deorphanization (identifying activating ligands) of OR1F12 faces several significant challenges common to many olfactory receptors. With more than 80% of human ORs remaining functionally uncharacterized, identifying specific ligands for OR1F12 requires addressing multiple technical and biological obstacles .

Key challenges include:

  • Functional Expression Barriers: Many ORs, potentially including OR1F12, show poor functional expression in heterologous systems like HEK293 cells, likely due to missing cofactors present in native olfactory neurons .

  • Receptor Trafficking Issues: ORs often fail to properly traffic to the plasma membrane in heterologous systems, necessitating the use of trafficking enhancers like RTP1S .

  • Signal Detection Limitations: High basal activity or weak coupling to downstream signaling pathways can complicate the detection of ligand-induced responses .

  • Odorant Screening Complexity: The chemical space of potential odorants is vast, making comprehensive screening logistically challenging.

  • Assay Sensitivity Requirements: Detection systems must be sufficiently sensitive to identify potentially subtle responses to odorants.

The search results indicate that OR1F12 was among 34 receptors tested during later screening phases , suggesting it might present particular challenges that required specialized approaches beyond standard methodologies.

How can the functional expression of OR1F12 be improved in heterologous systems?

Improving the functional expression of OR1F12 in heterologous systems requires a multifaceted approach addressing various aspects of GPCR expression and function. Based on research findings, several strategies can enhance OR1F12 expression and activity detection :

  • Co-expression with Accessory Proteins:

    • RTP1S significantly enhances the surface expression and function of ORs

    • The human RTP1S gene can be amplified from human genomic DNA and inserted into expression vectors like pME18S

  • Strategic Cell Line Selection:

    • Test multiple cell lines beyond HEK293, including LNCaP (especially for ORs with high basal activity), HepG2, and HuH7

    • Different cell lines provide varying cellular environments that may better support OR1F12 functionality

  • Optimized Vector Design:

    • N-terminal epitope tags like FLAG and rhodopsin tags (first 20 amino acids of bovine rhodopsin) improve surface expression

    • The FLAG-Rho tagging approach has proven effective for numerous ORs

  • Cell-Specific Transfection Optimization:

    • Tailored transfection reagents and DNA ratios for each cell line:

      • HEK293: PEI-MAX (0.1%, pH 7.5)

      • LNCaP: Lipofectamine 3000

      • HepG2/HuH7: Lipofectamine 2000

  • G Protein Considerations:

    • Include Gαolf for non-HEK293 cell lines to enhance coupling to the cAMP pathway

    • Gαolf can be amplified from cDNA derived from human lung tissue

These strategies can be implemented individually or in combination to overcome the expression challenges associated with OR1F12, potentially enabling successful functional characterization and ligand identification.

How should luciferase assay data for OR1F12 activation be analyzed?

Luciferase assay systems are commonly employed to detect activation of olfactory receptors, including OR1F12. A dual luciferase reporter system incorporating both CRE-dependent firefly luciferase and constitutively expressed Renilla luciferase provides a robust readout for receptor activation while controlling for transfection efficiency and cell number variations .

The recommended analytical approach for OR1F12 luciferase data includes:

  • Data Normalization:

    • Calculate the ratio of firefly luciferase activity to Renilla luciferase activity for each sample

    • This normalization accounts for well-to-well variations in transfection efficiency and cell number

  • Response Quantification:

    • Calculate fold change in normalized luciferase activity compared to appropriate controls:

      • Fold change = (Normalized ratio with odorant) ÷ (Normalized ratio with vehicle)

    • Alternative approach: Calculate percent response relative to a positive control

  • Statistical Analysis:

    • Apply appropriate statistical tests (t-tests, ANOVA) to determine if observed responses significantly differ from controls

    • Implement multiple comparison corrections when testing numerous conditions

  • Dose-Response Analysis:

    • For potential ligands, construct dose-response curves across a concentration range

    • Calculate EC50 values (concentration producing 50% of maximal response)

    • Assess efficacy (maximum response) and potency (EC50) parameters

  • Cross-Platform Validation:

    • Compare response patterns across different cell lines if multiple expression systems were used

    • Consistent responses across platforms provide stronger evidence for specific ligand activity

This structured analytical approach enables reliable identification of OR1F12 activators while minimizing false positives and negatives that might arise from experimental variability.

What statistical approaches are recommended for OR1F12 research?

Robust statistical analysis is essential for reliable interpretation of OR1F12 experimental data. Based on established principles of scientific research and the experimental designs described in the literature, several statistical approaches are recommended :

  • Descriptive Statistics:

    • Calculate means, medians, and standard deviations to characterize central tendency and variability

    • Assess distribution characteristics to determine appropriate subsequent analyses

  • Inferential Statistics:

    • Formulate clear null and alternative hypotheses

    • Select appropriate statistical tests based on data characteristics and experimental design

    • Consider both Type I (false positive) and Type II (false negative) error probabilities

  • Variability Control:

    • Implement measures to reduce unsystematic variability, which increases statistical power

    • As noted in the literature: "The lower the unsystematic variability (random error), the more sensitive is our statistical test to treatment effects"

  • Effect Size Quantification:

    • Calculate and report effect sizes alongside p-values

    • This provides information about the magnitude of observed effects, not just their statistical significance

  • Visual Data Representation:

    • Present results in both tabular and graphical formats

    • Raw data visualization through frequency distributions and histograms aids interpretation

    • Example approach:

TreatmentMean ResponseStandard DeviationSample Sizep-valueEffect Size
Vehicle1.000.159--
Odorant 12.450.389<0.0011.84
Odorant 21.120.2190.180.32

How can specific OR1F12 activation be distinguished from background responses?

Distinguishing genuine OR1F12 activation from non-specific background responses is crucial for accurate ligand identification. Several methodological approaches can help establish the specificity of observed responses:

  • Comprehensive Control Implementation:

    • Empty vector-transfected cells control for endogenous receptor activation

    • Vehicle controls account for potential solvent effects

    • Cells expressing unrelated receptors help identify non-specific responses

  • Pharmacological Validation:

    • Establish dose-dependency through concentration-response experiments

    • True receptor-mediated responses typically show sigmoid concentration-response relationships

    • EC50 values should be consistent with typical GPCR pharmacology (typically nanomolar to micromolar range)

  • Signal Amplification Assessment:

    • Co-expression with Gαolf in appropriate cell lines enhances OR-specific signaling

    • Cell line-specific optimization of signaling components can improve signal-to-noise ratio

  • Cross-Cell Line Verification:

    • Test potential ligands in multiple cell lines with different endogenous signaling backgrounds

    • Consistent responses across diverse cellular environments support OR1F12-specific effects

  • Statistical Thresholds:

    • Implement clear statistical criteria for "positive" responses

    • Responses might be considered significant only if they exceed 3 standard deviations above baseline

    • Apply multiple testing corrections when screening numerous compounds

For OR1F12 with potential high basal activity, careful baseline characterization is particularly important. Repeated measures of baseline activity across multiple experimental days can establish the normal range of variability, enabling more accurate identification of true ligand-induced responses above this baseline.

Why might OR1F12 show poor functional expression in heterologous cell systems?

Poor functional expression of OR1F12 in heterologous systems can result from multiple factors that impact receptor trafficking, folding, and signaling. Based on research findings, several explanations and solutions can be considered :

  • Missing Cofactors:

    • HEK293 and other cell lines may lack factors required for OR function that are present in olfactory neurons

    • Solution: Test multiple cell lines; LNCaP cells have shown success with certain ORs that failed in HEK293

  • Inefficient Trafficking:

    • ORs often remain trapped in intracellular compartments rather than reaching the plasma membrane

    • Solution: Co-express RTP1S, which enhances surface trafficking of ORs

  • Protein Misfolding:

    • The complex structure of OR1F12 may lead to incorrect folding in heterologous systems

    • Solution: Use N-terminal tagging strategies like FLAG-Rho tags that promote proper folding

  • Suboptimal Transfection:

    • Inadequate expression levels due to inefficient transfection

    • Solution: Optimize transfection conditions for each cell line using appropriate reagents :

      • HEK293: PEI-MAX (0.16 μL/well)

      • LNCaP: Lipofectamine 3000 (0.058 μL/well)

      • HepG2: Lipofectamine 2000 (0.14 μL/well)

      • HuH7: Lipofectamine 2000 (0.077 μL/well)

  • G-protein Coupling Inefficiency:

    • Poor coupling to endogenous G-proteins in heterologous systems

    • Solution: Co-express Gαolf in non-HEK293 cell lines to enhance signaling

These strategies can be implemented systematically to optimize OR1F12 expression and function, potentially enabling successful deorphanization and characterization.

How can high basal activity issues with OR1F12 be addressed?

High basal activity in OR1F12 can mask ligand-induced responses and complicate experimental interpretation. Based on research findings, several strategies can help address this challenge :

  • Optimal Cell Line Selection:

    • The LNCaP cell line has been specifically identified as effective for ORs with high basal activity

    • Research indicates LNCaP cells are particularly valuable "for functional expression of ORs, especially with a high basal activity, which impeded the sensitive detection of ligand-mediated activity of ORs"

  • Enhanced Normalization Approaches:

    • Implement dual-reporter systems (firefly and Renilla luciferase) for robust internal normalization

    • Consider analyzing raw signal differences rather than fold changes when baselines are very high

    • Establish Z-factor values to assess assay quality in the context of high baseline activity

  • Experimental Design Modifications:

    • Increase replicate numbers to better characterize baseline variability

    • Optimize cell density to achieve optimal signal-to-noise ratios

    • Evaluate different assay time points to identify optimal windows for detecting responses

  • Advanced Data Analysis:

    • Apply statistical methods specifically designed for high-variance data

    • Consider baseline subtraction approaches with appropriate controls

    • Implement plate normalization methods to account for positional and temporal effects

  • Molecular Engineering Approaches:

    • Test modified versions of OR1F12 with potentially reduced constitutive activity

    • Screen for inverse agonists that might reduce basal signaling

    • Co-express regulatory proteins that can modulate G-protein signaling activity

These approaches can be combined as needed to develop a robust experimental system capable of detecting ligand-induced responses despite high basal activity.

What common pitfalls should be avoided in OR1F12 research?

OR1F12 research presents several potential pitfalls that can compromise experimental outcomes and data interpretation. Awareness of these challenges enables researchers to implement preventative strategies :

  • Limited Cell Line Testing:

    • Pitfall: Relying solely on HEK293 cells, which may not support functional expression of OR1F12.

    • Prevention: Test multiple cell lines, particularly LNCaP for ORs with high basal activity .

  • Inadequate Expression System:

    • Pitfall: Omitting critical components needed for OR trafficking and function.

    • Prevention: Co-express RTP1S and include Gαolf when appropriate; use tagged OR constructs (FLAG-Rho) .

  • Poor Experimental Controls:

    • Pitfall: Insufficient controls leading to misinterpretation of non-specific effects.

    • Prevention: Implement comprehensive control strategy including empty vector, vehicle controls, and positive controls.

  • Suboptimal Transfection:

    • Pitfall: Inefficient transfection resulting in low expression levels.

    • Prevention: Optimize transfection conditions for each cell line using appropriate reagents and DNA ratios .

  • Inadequate Data Analysis:

    • Pitfall: Overlooking statistical requirements or misinterpreting variability.

    • Prevention: "Limit the extent of unsystematic variability" to increase sensitivity for detecting treatment effects .

  • Insufficient Replication:

    • Pitfall: Too few replicates to establish statistical significance.

    • Prevention: Perform multiple independent experiments with sufficient technical replicates.

  • Narrow Odorant Screening:

    • Pitfall: Testing too few odorants or inadequate concentration ranges.

    • Prevention: Screen diverse chemical structures across broad concentration ranges.

  • Overlooking Cell Line Differences:

    • Pitfall: Failing to account for cell line-specific responses.

    • Prevention: Compare results across multiple cell lines; recognize that OR1F12 may behave differently in various cellular environments .

By anticipating these common pitfalls and implementing appropriate preventative strategies, researchers can enhance the reliability and validity of their OR1F12 studies, potentially accelerating progress toward functional characterization of this olfactory receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.