Recombinant Human Olfactory receptor 1I1 (OR1I1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant OR1I1

Recombinant OR1I1 is produced in heterologous expression systems such as HEK293 cells or specialized cell lines like LNCaP (prostate carcinoma), which are optimized for functional GPCR expression . Key features include:

Protein Structure and Tags

  • Amino Acid Sequence: Full-length OR1I1 (1-355 residues) includes seven transmembrane domains characteristic of Class A GPCRs .

  • Epitope Tags: N-terminal FLAG and C-terminal rho1D4 tags are often added to facilitate purification and detection .

Expression and Purification

  • Expression Systems: HEK293 cells are commonly used, though LNCaP cells may enhance functional expression for ORs with high basal activity .

  • Purification Methods: Anti-FLAG immunoaffinity chromatography and size-exclusion chromatography yield monomeric and dimeric forms of OR1I1 .

Table 2: Research Tools for OR1I1

ApplicationProduct/Assay TypeSource/Reference
Protein QuantificationELISA Kit (Colorimetric)Abbexa Ltd
Functional AnalysiscAMP Luciferase Reporter AssayPLOS ONE
Structural StudiesRecombinant OR1I1 (Lyophilized)GeneBioSystems

Challenges and Future Directions

  • Ligand Deorphanization: Over 80% of ORs, including OR1I1, lack identified ligands due to expression hurdles .

  • Species-Specificity: Human ORs often behave differently in non-native systems, necessitating tailored cell lines .

  • Metalloprotein Interactions: ORs may require metal ions (e.g., Cu²⁺) for ligand binding, adding complexity to in vitro studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
OR1I1; Olfactory receptor 1I1; Olfactory receptor 19-20; OR19-20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR1I1
Target Protein Sequence
MEPEKQTEISEFFLQGLSEKPEHQTLLFTMFLSTYLVTIIGNALIILAIITDSHLHTPMY FFLFNLSLVDTLLSSTTVPKMLANIQAQSRAIPFVGCLTQMYAFHLFGTMDSFLLAVMAI DRFVAIVHPQRYLVLMCSPVCGLLLGASWMITNLQSLIHTCLMAQLTFCAGSEISHFFCD LMPLLKLSGSDTHTNELVIFAFGIVVGTSPFSCILLSYIRIFWTVFKIPSTRGKWKAFST CGLHLTVVSLSYGTIFAVYLQPTSPSSSQKDKAAALMCGVFIPMLNPFIYSIRNKDMKAA LGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8207

KEGG: hsa:126370

STRING: 9606.ENSP00000209540

UniGene: Hs.631610

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 1I1 and what cellular functions does it perform?

Olfactory receptor 1I1 (OR1I1) is a protein encoded by the OR1I1 gene in humans. It belongs to the extensive family of olfactory receptors that interact with odorant molecules in the nasal epithelium to initiate neuronal responses triggering smell perception. OR1I1 functions as a chemical sensor that detects odorants and converts this chemical signal into an electrical response through G-protein-mediated signal transduction pathways . As a member of the G-protein-coupled receptor (GPCR) superfamily, OR1I1 shares the characteristic seven-transmembrane domain structure common to many neurotransmitter and hormone receptors . The primary function of OR1I1 is to contribute to the discriminatory capacity of the human olfactory system, which can distinguish thousands of different odors through combinatorial activation patterns.

How does OR1I1 compare structurally and functionally to other olfactory receptors?

OR1I1 is structurally similar to other olfactory receptors with the typical GPCR architecture featuring seven transmembrane domains. Like other olfactory receptors, it arises from a single coding-exon gene and participates in the recognition and G protein-mediated transduction of odorant signals . The olfactory receptor gene family is the largest in the genome, with each receptor exhibiting unique ligand specificity profiles while maintaining structural homology . The nomenclature assigned to OR1I1 is independent of other organisms, reflecting the species-specific nature of olfactory receptor evolution . While specific structural details unique to OR1I1 are not extensively characterized in the provided sources, research methodologies similar to those used for other olfactory receptors, such as OR5AL1, can be applied for structural analysis .

What is the genetic basis of OR1I1 expression and regulation?

OR1I1 is encoded by a single exon gene, which is characteristic of the olfactory receptor family . The gene has several alternative designations in the literature, including OR19-20, OR1I1P, and OR1I1Q . The expression of OR1I1, like other olfactory receptors, follows the principle of "one neuron-one receptor," where each olfactory sensory neuron typically expresses only one type of olfactory receptor. Regulation of OR1I1 expression involves complex mechanisms ensuring this selective expression pattern. Although the specific regulatory elements controlling OR1I1 expression are not detailed in the provided sources, research on other olfactory receptors suggests involvement of enhancer elements, transcription factors, and epigenetic modifications. Understanding the genetic basis of OR1I1 expression is critical for experimental design when studying this receptor in both native and heterologous systems.

What are the optimal expression systems for recombinant OR1I1 production?

Based on methodologies applied to other olfactory receptors, several expression systems can be utilized for recombinant OR1I1 production. Cell-free expression systems have proven effective for producing recombinant olfactory receptors with high purity (≥85%), as demonstrated with OR5AL1 . For functional studies, mammalian cell expression systems such as Hana3A cells have been successfully employed for olfactory receptor expression . These cells are particularly valuable because they can be transfected with accessory factors like RTP1S that enhance receptor trafficking to the cell surface, which is critical for functional studies .

For recombinant OR1I1 production, a protocol similar to that used for other olfactory receptors would involve:

  • Amplification of the OR1I1 open reading frame from genomic DNA using high-fidelity polymerase

  • Subcloning into appropriate expression vectors (e.g., pCI) containing tags like the first 20 residues of human rhodopsin to enhance membrane expression

  • Verification of the cloned sequence through sequencing

  • Expression in either cell-free systems (for biochemical and structural studies) or mammalian cells (for functional assays)

The selection of expression system should be guided by the specific research objectives, with cell-free systems favored for protein production and mammalian cells for functional characterization .

What challenges are associated with heterologous expression of OR1I1 and how can they be overcome?

Heterologous expression of olfactory receptors, including OR1I1, presents several challenges:

  • Poor plasma membrane trafficking: Olfactory receptors often fail to reach the cell surface in heterologous systems, remaining trapped in the endoplasmic reticulum.

    • Solution: Co-expression with trafficking enhancers such as RTP1S significantly improves membrane localization .

  • Low functional expression levels: Even when expressed, receptor numbers may be insufficient for robust signaling.

    • Solution: Optimization of transfection conditions and use of expression-enhancing elements in vector design.

  • Correct folding and post-translational modifications: GPCRs require proper folding to maintain functionality.

    • Solution: Use of specialized cell lines and optimization of growth conditions.

  • Coupling to appropriate G proteins: Effective signal transduction requires interaction with compatible G proteins.

    • Solution: Co-transfection with appropriate G-protein subunits or using cell lines expressing compatible G proteins.

The methodology employed in the comprehensive screening of olfactory receptors described by researchers included co-transfection of Hana3A cells with multiple components: the receptor (5 ng/well), RTP1S (5 ng/well), a luciferase reporter (10 ng/well), and additional signaling components like M3 (2.5 ng/well) . This combinatorial approach effectively addresses many of the challenges associated with functional expression of olfactory receptors in heterologous systems.

What purification strategies yield the highest purity and activity for recombinant OR1I1?

While specific purification protocols for OR1I1 are not detailed in the provided sources, the following strategy based on successful approaches with other olfactory receptors would likely be effective:

  • Affinity purification: Incorporation of affinity tags (His-tag, FLAG-tag, or Rho-tag) facilitates selective purification using affinity chromatography.

  • Size exclusion chromatography: This technique separates proteins based on molecular weight and can be used as a polishing step to achieve higher purity.

  • Detergent selection: Critical for maintaining the native conformation of membrane proteins like OR1I1. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are often preferred.

  • Buffer optimization: Stabilizing agents and appropriate pH conditions can significantly enhance protein stability during purification.

For recombinant OR5AL1, a purity of ≥85% was achieved and the protein was suitable for SDS-PAGE analysis . Similar approaches would be applicable to OR1I1 purification, with optimization specific to this receptor's properties. The purification strategy should be tailored to the intended downstream applications, with more stringent purification required for structural studies compared to functional assays.

What are the most reliable assays for measuring OR1I1 activation and response?

The luciferase reporter assay system has emerged as a gold standard for measuring olfactory receptor activation in heterologous systems. Specifically, the Dual-Glo Luciferase Assay System offers a robust platform for quantitative assessment of receptor responses . The methodology involves:

  • Transfection of cells (e.g., Hana3A) with:

    • The OR1I1 receptor construct

    • A CRE-luciferase reporter (responds to cAMP increases)

    • A constitutively expressed Renilla luciferase (for normalization)

    • Accessory proteins such as RTP1S to enhance surface expression

    • Additional signaling components if needed

  • Stimulation with potential ligands at various concentrations

  • Measurement of luminescence using a plate reader such as the Polarstar Optima

  • Normalization of firefly luciferase values to Renilla luciferase activity to control for transfection efficiency

This methodology has been successfully applied to screen hundreds of olfactory receptors against panels of odorants . For OR1I1 specifically, this approach would allow for systematic identification of ligands and characterization of dose-response relationships. Alternative methods include calcium imaging, which measures intracellular calcium flux upon receptor activation, and electrophysiological techniques for direct measurement of electrical responses in cells expressing the receptor.

How should dose-response experiments be designed for OR1I1 characterization?

Based on established protocols for olfactory receptor characterization, dose-response experiments for OR1I1 should follow this methodological framework:

  • Concentration range selection:

    • Typically spanning from 10 nM to 10 mM to capture the full response range

    • Using half-log or quarter-log dilution series for optimal resolution

  • Experimental controls:

    • Vector-only transfected cells as negative controls

    • Known responsive receptor as positive control

    • Multiple replicates (at least triplicate) for each concentration

  • Data collection protocol:

    • Transfect cells with OR1I1 and necessary components

    • 24 hours post-transfection, remove media and apply odorants at various concentrations

    • Measure response after appropriate incubation (typically 4 hours for luciferase assays)

  • Data analysis:

    • Normalize data to controls

    • Fit to sigmoidal dose-response curves

    • Extract key parameters: EC50, Emax, and Hill coefficient

    • Apply statistical tests to determine significant activation above baseline

An odorant should be considered an agonist if:

  • The 95% confidence intervals of the top and bottom parameters do not overlap

  • The standard deviation of the fitted log EC50 is less than 1 log unit

  • Statistical testing confirms that the odorant activates the receptor significantly more than the control

This approach allows for systematic characterization of OR1I1's response properties and comparison with other olfactory receptors.

What analytical techniques can elucidate OR1I1 ligand binding mechanisms?

Understanding the molecular mechanisms of ligand binding to OR1I1 requires sophisticated analytical approaches:

  • Computational modeling and docking:

    • Homology modeling based on known GPCR structures

    • Molecular docking simulations to predict ligand binding sites

    • Molecular dynamics simulations to understand binding kinetics

  • Site-directed mutagenesis:

    • Systematic mutation of predicted binding pocket residues

    • Functional testing of mutants to identify critical residues

    • Comparison with related receptors to identify conserved binding mechanisms

  • Biophysical methods:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Fluorescence-based binding assays for high-throughput screening

  • Structural biology approaches:

    • X-ray crystallography (challenging for GPCRs)

    • Cryo-electron microscopy for structural determination

    • NMR spectroscopy for dynamic aspects of ligand binding

These complementary approaches can collectively provide insights into how OR1I1 recognizes and binds different odorants. The information can then be integrated into models of olfactory perception, contributing to our understanding of the combinatorial code in olfaction .

How does OR1I1 contribute to the evolutionary understanding of olfactory receptors?

OR1I1 represents an important component in the evolutionary landscape of olfactory receptors. Olfactory receptors are classified into two main groups: Class I (fish-like receptors) and Class II (tetrapod-specific receptors) . Understanding OR1I1's classification and evolutionary history provides insights into the adaptation of olfactory systems across species.

Comparative genomic analysis of OR1I1 orthologs across species can reveal:

  • Conservation of key functional domains, suggesting evolutionary pressure to maintain certain olfactory capabilities

  • Species-specific variations that might reflect adaptation to different ecological niches

  • Evidence of positive selection that could indicate specialization for detecting specific odorants important in particular environments

The independent nomenclature system for human olfactory receptors, including OR1I1, reflects the rapid evolution and diversification of these genes across species . This diversification likely contributed to species-specific olfactory capabilities, enabling adaptation to various ecological contexts.

Studying OR1I1 in the context of the entire olfactory receptor family helps illuminate how the remarkable diversity of these receptors evolved, supporting the discrimination of countless odorants through combinatorial coding strategies.

What structural and functional differences exist between human OR1I1 and its orthologs in other species?

While detailed comparative analysis of OR1I1 across species is not provided in the search results, general principles of olfactory receptor evolution suggest several key differences likely exist:

  • Sequence variations: Comparisons between human OR1I1 and orthologs in other species (referenced in external databases like HomoloGene: 72920 and OMA:OR1I1) would reveal:

    • Conserved residues critical for general GPCR function

    • Variable regions that may contribute to species-specific ligand preferences

    • Transmembrane domain differences affecting binding pocket architecture

  • Ligand specificity profiles:

    • Species-specific tuning reflecting ecological requirements

    • Different affinity or efficacy for shared ligands

    • Potentially unique ligand recognition capabilities

  • Expression patterns:

    • Variable expression levels in olfactory epithelium

    • Different spatial distribution patterns across the olfactory mucosa

    • Species-specific regulatory mechanisms

  • Signal transduction efficiency:

    • Variations in coupling efficiency to G-proteins

    • Differences in desensitization and adaptation mechanisms

    • Species-specific post-translational modifications affecting function

These differences reflect evolutionary adaptations to different environmental pressures and ecological niches. Comparative studies of OR1I1 across species can provide insights into the molecular basis of species-specific olfactory capabilities and the evolution of chemosensory systems more broadly.

How does OR1I1 function within the broader combinatorial code of human olfaction?

OR1I1 operates as part of the complex combinatorial coding system that enables humans to discriminate thousands of distinct odors. Within this system:

The combinatorial nature of olfactory coding means that understanding OR1I1's function requires:

  • Identifying its complete response spectrum across diverse odorants

  • Determining how its activation correlates with specific perceptual qualities

  • Examining how it functions in concert with other receptors to encode complex odors

This systems-level understanding of OR1I1's role is essential for deciphering the neural code of olfaction and developing predictive models of odor perception.

What strategies overcome the challenges in high-throughput screening of ligands for OR1I1?

High-throughput screening (HTS) for OR1I1 ligands presents several challenges that can be addressed through strategic methodological approaches:

  • Primary screen optimization:

    • Implementation of a plate-based design with appropriate controls (similar to the approach used in comprehensive OR screening)

    • Inclusion of standard receptors (e.g., Olfr544 stimulated with a known ligand like nonanedioic acid) for normalization across plates

    • Use of baseline plates (no odor) to establish reference activity levels

  • Data normalization and hit selection:

    • Standardization of each plate using reference receptor responses

    • Subtraction of baseline responses for each receptor

    • Selection of top-performing odor/receptor pairs (e.g., top 5% or top ten ligands) for secondary validation

  • Secondary screening and validation:

    • Testing selected hits at multiple concentrations (e.g., 1, 10, and 100 μM)

    • Running all tests in triplicate to ensure reproducibility

    • Statistical validation to identify significant responses

  • Comprehensive dose-response analysis:

    • Full dose-response curves using wide concentration ranges (10 nM to 10 mM)

    • Statistical validation using confidence intervals and appropriate hypothesis testing

    • Vector-only controls to confirm receptor-specific responses

This systematic approach allows for efficient screening of large odorant libraries while maintaining experimental rigor. The methodology can be adapted specifically for OR1I1 based on its expression characteristics and signal transduction properties.

How can OR1I1 research contribute to understanding olfactory perception disorders?

Research on OR1I1 can provide valuable insights into olfactory perception disorders through several approaches:

Olfactory dysfunction affects approximately 5% of the general population and can severely impact quality of life. By understanding the molecular basis of OR1I1 function and dysfunction, researchers can contribute to improved diagnostics and potential therapeutic strategies for olfactory disorders.

What methodological approaches can elucidate OR1I1's role in neural coding of olfactory information?

Understanding OR1I1's contribution to neural coding requires integrating molecular techniques with systems neuroscience approaches:

  • In vitro to in vivo translation:

    • Correlation of ligand identification in heterologous systems with in vivo responses

    • Development of OR1I1-specific tools (antibodies, genetic reporters) for tracking expression and activation

    • Use of genetic models with modified OR1I1 expression or function

  • Functional imaging techniques:

    • Calcium imaging of olfactory sensory neurons expressing OR1I1

    • Voltage imaging to capture temporal dynamics of signal transduction

    • In vivo imaging of glomerular activation patterns in response to OR1I1 ligands

  • Electrophysiological approaches:

    • Patch-clamp recordings from identified OR1I1-expressing neurons

    • Field potential recordings from glomeruli receiving OR1I1 neuron projections

    • Multi-electrode array recordings to capture population-level activity

  • Computational modeling:

    • Integration of molecular data into predictive models of receptor activation

    • Network models incorporating OR1I1 activity patterns

    • Machine learning approaches to decipher complex coding relationships

  • Behavioral assays:

    • Psychophysical testing with OR1I1-specific ligands

    • Correlation of genetic variation with perceptual differences

    • Targeted manipulation of OR1I1-expressing neurons and assessment of behavioral impacts

These complementary approaches can collectively elucidate how OR1I1 contributes to the encoding of olfactory information at multiple levels of the system, from molecular recognition to perception.

What statistical approaches are most appropriate for analyzing OR1I1 receptor response data?

Robust statistical analysis of OR1I1 response data requires careful consideration of experimental design and data characteristics:

  • Normalization strategies:

    • Division of luciferase activity by Renilla luciferase to control for transfection efficiency

    • Normalization to standard receptor responses for cross-plate comparability

    • Baseline subtraction to account for constitutive activity

  • Hypothesis testing for agonist identification:

    • Comparison of receptor responses to vector-only controls

    • Application of extra sums-of-squares test to confirm significant activation

    • Use of 95% confidence intervals to evaluate separation between parameters

  • Dose-response curve analysis:

    • Fitting to sigmoidal models to extract EC50, Emax, and Hill coefficient

    • Validation of model quality (standard deviation of fitted log EC50 < 1 log unit)

    • Comparison of curve parameters across different ligands

  • Multiple testing correction:

    • Application of appropriate corrections (e.g., Bonferroni, Benjamini-Hochberg) when screening multiple compounds

    • Balancing type I and type II errors based on screening goals

  • Multivariate analysis for receptor comparison:

    • Principal component analysis to identify response patterns across receptors

    • Hierarchical clustering to group receptors with similar response profiles

    • Multi-dimensional scaling to visualize relationships between receptors and ligands

These statistical approaches ensure rigorous interpretation of OR1I1 functional data, facilitating comparison with other receptors and integration into broader models of olfactory coding.

How can researchers differentiate between specific and non-specific responses in OR1I1 studies?

Distinguishing specific from non-specific responses is critical for accurate characterization of OR1I1:

  • Essential controls:

    • Vector-only transfected cells to establish baseline responses to compounds

    • Multiple negative control receptors (preferably related to OR1I1) to identify broadly activating compounds

    • Concentration-response relationships (specific responses typically show dose-dependence)

  • Validation criteria:

    • Reproducibility across independent experiments

    • Statistical significance compared to controls

    • Pharmacologically reasonable EC50 values

    • Appropriate Hill coefficients for receptor-mediated responses

  • Specificity confirmation approaches:

    • Structure-activity relationship analysis with chemically related compounds

    • Competitive binding assays with known ligands

    • Receptor mutagenesis to confirm binding site involvement

    • Antagonist studies to block putative specific responses

  • Advanced verification:

    • Direct binding assays where feasible

    • Orthogonal assay systems measuring different aspects of receptor activation

    • In vivo validation where possible (e.g., in genetically modified systems)

The methodology employed in comprehensive screening studies provides a template for distinguishing specific from non-specific effects through systematic application of controls, statistical validation, and dose-response analysis .

Table 1: Criteria for Validating Specific OR1I1 Responses
Criterion
Dose-Dependency
EC50 Value
Hill Coefficient
Vector Control
Reproducibility
Structure-Activity Relationship

What are the critical considerations for data integration in multi-omics studies involving OR1I1?

Multi-omics approaches to studying OR1I1 require thoughtful integration strategies:

  • Data types and integration challenges:

    • Genomic data (variants, expression quantitative trait loci)

    • Transcriptomic data (expression levels, splice variants)

    • Proteomic data (post-translational modifications, interaction partners)

    • Functional data (ligand responses, signaling outputs)

    • Phenotypic data (perceptual measurements, behavioral responses)

  • Data preprocessing considerations:

    • Normalization appropriate to each data type

    • Batch effect correction across experiments

    • Missing data handling strategies

    • Dimension reduction where appropriate

  • Integration methodologies:

    • Correlation-based approaches linking features across data types

    • Network-based methods identifying functional relationships

    • Machine learning models for predictive integration

    • Causal modeling to infer mechanistic relationships

  • Validation strategies:

    • Cross-validation within datasets

    • Independent validation cohorts

    • Experimental verification of key predictions

    • Comparison with known biology of related receptors

  • Interpretation frameworks:

    • Pathway and ontology enrichment analysis

    • Comparison with other olfactory receptors

    • Evolutionary context and comparative genomics

    • Integration with existing olfactory system models

These considerations ensure that multi-omics data related to OR1I1 can be effectively integrated to generate meaningful biological insights, contributing to a comprehensive understanding of this receptor's role in olfaction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.