Recombinant Human Olfactory receptor 1L1 (OR1L1)

Shipped with Ice Packs
In Stock

Description

Functional and Research Findings

OR1L1’s ligand specificity and signaling mechanisms are inferred from general OR studies and limited direct data:

Ligand Binding and Signaling

  • Odorant Detection: Likely recognizes hydrophobic odorants (class II ORs) via interactions with conserved residue motifs .

  • G-Protein Coupling: Activates G<sub>olf</sub> or G<sub>s</sub>, triggering cAMP production and ion channel opening .

Expression Systems

Recombinant OR1L1 is expressed in heterologous systems like HEK293 or LNCaP cells, often requiring chaperones (e.g., RTP1) for proper folding .

SystemAdvantageLimitation
HEK293High transfection efficiency Low expression for some ORs
LNCaPEndogenous OR expression High basal activity complicates assays

Applications in Research

While direct applications for OR1L1 are unreported, its potential aligns with broader OR-based technologies:

Odorant Detection Platforms

  • Cell Array Sensors: HEK293T cells stably expressing OR1L1 (among 388 ORs) could enable high-throughput odorant profiling via calcium or cAMP assays .

  • Ligand Screening: LNCaP cells may identify novel agonists for OR1L1, particularly for receptors with high basal activity .

Therapeutic and Diagnostic Use

  • Drug Discovery: ORs like OR1L1 are targets for modulating olfactory-related pathways in diseases (e.g., neurodegeneration) .

  • Biosensors: Engineered OR1L1 for detecting specific odorants in environmental or clinical monitoring .

Key Challenges

  • Low Expression: Recombinant OR1L1 requires optimized purification (e.g., FLAG/rho1D4 tags) .

  • Ligand Deorphanization: >80% of human ORs lack known ligands, including OR1L1 .

  • Heterogeneity: Dimeric forms (observed in other ORs) may affect signaling .

Research Gaps

  • Structural Data: No crystallographic/NMR studies for OR1L1; reliance on homology models .

  • Species-Specificity: OR1L1’s role in human olfaction vs. other tissues remains uncharacterized .

Comparative Analysis of OR Databases

M2OR, the largest OR-odorant database, catalogs 51,395 pairs but lacks OR1L1-specific entries . Below is a comparison of OR databases:

DatabaseOR1L1 EntriesKey StrengthsLimitations
M2ORNone51,395 OR-molecule pairs; includes mixtures Focus on rodent ORs
OdorDBNoneEarly OR-odorant mappingObsolete
OlfactionBaseNoneCurated human OR dataSmall dataset

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
OR1L1; OR1L2; Olfactory receptor 1L1; Olfactory receptor 1L2; Olfactory receptor 9-C; OR9-C; Olfactory receptor OR9-27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR1L1
Target Protein Sequence
MERNHNPDNCNVLNFFFADKKNKRRNFGQIVSDVGRICYSVSLSLGEPTTMGRNNLTRPS EFILLGLSSRPEDQKPLFAVFLPIYLITVIGNLLIILAIRSDTRLQTPMYFFLSILSFVD ICYVTVIIPKMLVNFLSETKTISYSECLTQMYFFLAFGNTDSYLLAAMAIDRYVAICNPF HYITIMSHRCCVLLLVLSFCIPHFHSLLHILLTNQLIFCASNVIHHFFCDDQPVLKLSCS SHFVKEITVMTEGLAVIMTPFSCIIISYLRILITVLKIPSAAGKRKAFSTCGSHLTVVTL FYGSISYLYFQPLSNYTVKDQIATIIYTVLTPMLNPFIYSLRNKDMKQGLAKLMHRMKCQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8213

KEGG: hsa:26737

STRING: 9606.ENSP00000310773

UniGene: Hs.567736

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR1L1 and how is it classified among olfactory receptors?

OR1L1 (Olfactory receptor 1L1) is a member of the olfactory receptor family, which belongs to the class A G-protein-coupled receptors (GPCRs). It is specifically classified as a Class O2 (tetrapod specific odorant) receptor within the Odorant family 1. OR1L1 is also known by several alternative names including Olfactory receptor 1L2, Olfactory receptor 9-C (OR9-C), and Olfactory receptor OR9-27 . Olfactory receptors constitute the largest transmembrane protein family in the human genome and play a crucial role in detecting odorant molecules present in the surrounding environment . The OR1L1 gene is located on chromosome 9q33.2 in humans .

What is the molecular structure and sequence characteristics of OR1L1?

OR1L1 is a transmembrane protein with the typical seven-transmembrane domain structure characteristic of GPCRs. The protein sequence begins with an N-terminal domain followed by alternating transmembrane domains (TM1-TM4 are visible in the provided sequence data) connected by intracellular loops (ICL) and extracellular loops (ECL) . The partial sequence data shows that the N-terminal domain contains approximately 70 amino acids before the first transmembrane domain begins. The protein exhibits structural features common to class A GPCRs, including conserved motifs essential for G-protein coupling and signal transduction .

What is the functional role of OR1L1 in the olfactory system?

OR1L1 functions as a chemoreceptor that detects odorant molecules and initiates a neuronal response that triggers olfactory perception. Like other olfactory receptors, OR1L1 operates through GPCR signaling mechanisms, predominantly coupling with G proteins that activate the cAMP pathway. When an odorant molecule binds to OR1L1, it induces conformational changes that lead to G-protein activation, which subsequently triggers a signaling cascade resulting in neuronal depolarization and signal transmission to the brain . Functional studies have shown that within the OR family, some members (like OR1L1) respond to a specific set of structurally related odorants, while others may have broader response profiles to more diverse odorant structures .

What are the most effective systems for recombinant expression of OR1L1?

For successful recombinant expression of OR1L1, tetracycline-inducible HEK293S cell lines have been demonstrated to be effective expression systems. The methodology involves engineering the receptor with epitope tags to facilitate purification and detection. Specifically, inserting a C-terminal rho1D4 epitope tag and an N-terminal FLAG epitope tag allows for subsequent purification and functional verification .

The expression protocol typically involves:

  • Generating a stable tetracycline-inducible HEK293S cell line containing the engineered OR1L1 gene

  • Culturing cells in appropriate media with tetracycline induction

  • Harvesting cells after optimal expression time (typically 48-72 hours post-induction)

  • Verifying expression through Western blot analysis using antibodies against the epitope tags

This expression system is advantageous as it provides control over expression timing and level, critical for obtaining properly folded functional receptors.

What purification strategies yield the highest quality OR1L1 protein preparations?

A two-step purification protocol has been effectively used to obtain high-quality OR1L1 preparations:

  • First step: Monoclonal anti-FLAG immunoaffinity purification

    • Solubilize cells in appropriate detergent buffer

    • Apply solubilized material to anti-FLAG affinity column

    • Wash extensively to remove non-specifically bound proteins

    • Elute with FLAG peptide

  • Second step: Gel filtration chromatography

    • Apply eluate from immunoaffinity step to size exclusion column

    • Separate monomeric and oligomeric forms of the receptor

    • Collect fractions containing the purified receptor

This protocol has been shown to yield approximately 1.6 mg of monomeric and 1.1 mg of dimeric forms of FLAG-rho1D4-tagged OR1L1 from sixty T175 flasks of cultured cells . Following purification, circular dichroism analysis can confirm that the purified receptor maintains proper folding, which is critical for functional studies.

How can researchers verify the structural integrity of purified OR1L1?

Researchers can employ several complementary techniques to verify the structural integrity of purified OR1L1:

  • Circular Dichroism (CD) Analysis: This spectroscopic technique provides information about the secondary structure content of the purified protein. Properly folded OR1L1 should exhibit characteristic spectral features indicative of its predominantly alpha-helical structure .

  • Size Exclusion Chromatography-Multi-Angle Light Scattering (SEC-MALS): This technique allows determination of the oligomeric state and homogeneity of the purified receptor. SEC-MALS analysis has shown that purified OR1L1 exists in both monomeric and dimeric forms, with approximate molecular weights corresponding to the theoretical values based on amino acid sequence .

  • Ligand Binding Assays: Functional verification through ligand binding assays using intrinsic tryptophan fluorescence can confirm that the purified receptor retains its ability to bind cognate odorants. Studies have shown that detergent-solubilized FLAG-rho1D4-tagged OR1L1 binds its cognate odorant, dihydrojasmone, with affinity in the micromolar range .

What methodologies are most effective for analyzing OR1L1 ligand binding properties?

For analyzing OR1L1 ligand binding properties, several complementary methodologies have proven effective:

  • Intrinsic Tryptophan Fluorescence Assay: This technique utilizes the natural fluorescence of tryptophan residues that often change upon ligand binding due to conformational alterations in the receptor. Research has demonstrated that this approach can effectively quantify binding of cognate odorants like dihydrojasmone to detergent-solubilized OR1L1, with binding affinities in the micromolar range .

  • Real-time cAMP Assays: When evaluating the functional activity of OR1L1 in heterologous cell systems, real-time cAMP assays provide a dynamic measurement of receptor activation. These assays monitor changes in intracellular cAMP levels following ligand binding and G-protein activation, offering insights into both the potency and efficacy of different ligands .

  • Calcium Imaging: Although not explicitly mentioned in the search results for OR1L1, calcium imaging is a commonly used technique for functional characterization of olfactory receptors, measuring intracellular calcium flux upon receptor activation.

For optimal results, researchers should implement multiple complementary approaches to comprehensively characterize the binding properties and functional responses of OR1L1 to various potential ligands.

How can researchers effectively analyze OR1L1 signaling pathways and their regulation?

To effectively analyze OR1L1 signaling pathways and their regulation, researchers can implement the following methodologies:

  • Real-time cAMP Measurement: Since OR1L1 predominantly signals through G proteins that modulate cAMP levels, measuring real-time changes in intracellular cAMP concentrations provides direct insight into receptor activation and signaling dynamics .

  • Pathway Analysis (PA) Approaches: These analytical methods can be used to understand the broader signaling context:

    • Overrepresentation analysis (ORA)

    • Functional class scoring (FCS)

    • Pathway topology-based analysis (PTB)

  • Master Regulators Analysis: Utilizing computational tools like corto (Correlation Tool) can help identify transcription factors that may regulate OR1L1 expression or be affected by its signaling:

    • Generate regulatory networks based on expression correlation

    • Identify target genes and regulons

    • Perform Gene Set Enrichment Analysis (GSEA) to calculate Normalized Enrichment Scores (NES)

Analysis ApproachPurposeImplementation
Overrepresentation AnalysisIdentifies enriched pathways in gene setsStatistical comparison against background distribution
Functional Class ScoringDetects subtle but coordinated changes in pathwaysAggregates gene-level statistics into pathway-level statistics
Pathway Topology-Based AnalysisIncorporates pathway structure informationUses network topology to refine pathway analysis
Master Regulators AnalysisIdentifies key transcription factorsCorrelation-based approach with bootstrapping validation

These approaches allow researchers to move beyond simple receptor-ligand interactions to understand the broader cellular consequences of OR1L1 activation.

What techniques can be used to study OR1L1 interaction with G proteins and downstream effectors?

Several sophisticated techniques can be employed to study OR1L1 interactions with G proteins and downstream effectors:

  • BRET/FRET Assays (Bioluminescence/Fluorescence Resonance Energy Transfer): These techniques allow real-time monitoring of protein-protein interactions in living cells by measuring energy transfer between donor and acceptor molecules attached to the proteins of interest. For OR1L1, this could involve tagging the receptor and G protein subunits to monitor their association upon ligand binding.

  • Co-immunoprecipitation (Co-IP): This biochemical technique can be used to isolate OR1L1 along with its interaction partners from cell lysates. The purified FLAG-rho1D4-tagged OR1L1 described in the literature provides an excellent platform for such studies, as the epitope tags facilitate efficient immunoprecipitation.

  • Phosphoproteomic Analysis: Mass spectrometry-based phosphoproteomic approaches can identify phosphorylation events triggered downstream of OR1L1 activation, revealing key components of the signaling cascade.

  • Transcriptional Reporter Assays: These assays use reporter genes driven by response elements that are activated by transcription factors downstream of OR1L1 signaling, providing a readout of pathway activation. The master regulators analysis approach described in search result could inform the selection of appropriate reporter constructs.

How can structural biology approaches be applied to OR1L1 research?

Advanced structural biology approaches can provide crucial insights into OR1L1 function and ligand interactions:

  • X-ray Crystallography and NMR Studies: The successful purification of stable, properly folded OR1L1 in sufficient quantities (1.6 mg monomeric and 1.1 mg dimeric forms from sixty T175 flasks) paves the way for crystallographic and NMR studies . These techniques could reveal the three-dimensional structure of OR1L1, including the ligand-binding pocket and conformational changes associated with activation.

  • Cryo-Electron Microscopy (Cryo-EM): This rapidly advancing technique allows visualization of protein structures in their native state without the need for crystallization. For OR1L1 research, Cryo-EM could be particularly valuable for studying the receptor in complex with its G protein signaling partners.

  • Molecular Dynamics Simulations: Computational approaches can complement experimental structural data by simulating the dynamic behavior of OR1L1 in a lipid bilayer environment and predicting ligand binding modes. These simulations can generate testable hypotheses about residues critical for ligand recognition and binding.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can provide information about the solvent accessibility and dynamics of different regions of OR1L1, offering insights into conformational changes associated with ligand binding.

The purification protocols established for FLAG-rho1D4-tagged hOR1A1 provide a valuable methodological framework that can be adapted for OR1L1 structural studies.

What genetic tools and approaches are available for studying OR1L1 variants and their functional consequences?

Researchers have several sophisticated genetic tools at their disposal for studying OR1L1 variants:

  • Next-Generation Sequencing (NGS) Approaches: Clinical genetic testing of OR1L1 employs NGS/Massively parallel sequencing for comprehensive detection of variants, including deletion/duplication analysis . These technologies can be adapted for research purposes to characterize the spectrum of naturally occurring OR1L1 variants in different populations.

  • CRISPR/Cas9 Genome Editing: This technology enables precise modification of the OR1L1 gene to introduce specific variants of interest or to create knockout models. Resulting cell lines can be subjected to functional analysis to determine how specific variants affect receptor expression, trafficking, ligand binding, and signaling.

  • Variant Effect Prediction Tools: Computational approaches can predict the functional consequences of OR1L1 variants based on evolutionary conservation, structural context, and biochemical properties. These predictions can guide the selection of variants for detailed experimental characterization.

  • Reporter Gene Assays: Variants of OR1L1 can be coupled to reporter systems to quantitatively assess their functional properties in response to odorant stimulation. These assays can reveal differences in basal activity, ligand sensitivity, and maximal response among variants.

When interpreting OR1L1 variants, clinical genetic testing follows specific protocols for classifying variants as pathogenic, likely pathogenic, variants of uncertain significance (VUS), likely benign, or benign . Similar frameworks can be adapted for research contexts to systematize the functional classification of OR1L1 variants.

How can OR1L1 research contribute to understanding broader olfactory system function and dysfunction?

OR1L1 research can provide significant insights into the broader olfactory system:

  • Receptor-Ligand Specificity Principles: Detailed characterization of OR1L1 binding to odorants like dihydrojasmone contributes to understanding the molecular basis of odorant recognition. By comparing the ligand binding properties of OR1L1 with other olfactory receptors, researchers can elucidate the structural features that determine receptor specificity and the combinatorial coding principles underlying odor perception.

  • Signal Transduction Mechanisms: Studies of OR1L1 signaling through cAMP pathways illuminate common and divergent mechanisms of signal transduction among olfactory receptors. This knowledge is crucial for understanding how the diversity of olfactory receptor responses is integrated into coherent olfactory perceptions.

  • Genetic Basis of Olfactory Variation: Research on OR1L1 variants can contribute to understanding individual differences in olfactory perception. By correlating genetic variants with functional receptor properties, researchers can begin to explain why individuals perceive certain odors differently.

  • Olfactory Disorders: OR1L1 research may provide insights into specific anosmias (inability to smell particular odorants) or more general olfactory dysfunction. For example, if OR1L1 is found to respond to clinically relevant odorants, variants affecting its function might explain specific perceptual deficits.

  • Evolutionary Perspectives: Comparative studies of OR1L1 across species can reveal how evolutionary pressures have shaped olfactory receptor function, providing insights into the adaptive significance of specific receptor properties.

What are the common challenges in OR1L1 expression and purification, and how can they be addressed?

Researchers working with OR1L1 and other olfactory receptors frequently encounter several experimental challenges:

  • Low Expression Levels: Olfactory receptors often express poorly in heterologous systems.

    • Solution: The tetracycline-inducible HEK293S cell system has proven effective for OR1L1 expression . Optimizing induction conditions (timing, concentration) and incorporating chaperones or chemical chaperones can further enhance expression levels.

  • Protein Misfolding: Ensuring proper folding of OR1L1 is critical for functional studies.

    • Solution: Circular dichroism analysis should be performed to verify proper folding of purified receptor . Adding ligands during expression and purification can stabilize native conformations.

  • Detergent Selection: The choice of detergent significantly impacts receptor stability and activity.

    • Solution: Systematic screening of detergents for solubilization and purification, potentially incorporating cholesterol or other lipids to maintain a native-like environment.

  • Receptor Heterogeneity: The presence of both monomeric and dimeric forms of OR1L1 (as shown by SEC-MALS analysis) can complicate functional studies.

    • Solution: Size exclusion chromatography can effectively separate these forms. Researchers should characterize the functional properties of both forms to determine their physiological relevance.

  • Stability During Storage: Purified receptors may lose activity during storage.

    • Solution: Optimization of buffer conditions, addition of stabilizing agents, and appropriate temperature selection (typically -80°C for long-term storage with flash-freezing to minimize freeze-thaw damage).

What are the key considerations for designing valid functional assays for OR1L1?

When designing functional assays for OR1L1, researchers should consider several critical factors:

  • Selection of Appropriate Cell System:

    • HEK293S cells have been successfully used for OR1L1 expression and functional studies

    • Consider including accessory proteins that may enhance receptor trafficking or coupling to signaling machinery

    • Ensure the cell system expresses appropriate G protein subunits for OR1L1 coupling

  • Assay Sensitivity and Dynamic Range:

    • Real-time cAMP assays have been validated for OR1L1 functional analysis

    • Calibrate assay to ensure it can detect both low-efficacy partial agonists and full agonists

    • Include appropriate positive controls (known agonists like dihydrojasmone) and negative controls

  • Ligand Preparation and Handling:

    • Many odorants have low water solubility and may require solubilization in DMSO or other vehicles

    • Control for vehicle effects in all experiments

    • Account for potential volatility and degradation of odorant compounds during experimental procedures

  • Data Analysis and Interpretation:

    • Employ appropriate curve-fitting for dose-response relationships

    • Consider both potency (EC50) and efficacy (maximal response) parameters

    • Account for potential biases in assay systems when comparing different ligands

  • Reproducibility Considerations:

    • Standardize cell passage number and culture conditions

    • Perform biological replicates across different batches of cells

    • Include internal standards to normalize between experimental runs

How can researchers resolve data inconsistencies and contradictions in OR1L1 functional studies?

Resolving data inconsistencies in OR1L1 research requires systematic approaches:

  • Methodological Standardization:

    • Document and standardize protocols for receptor expression, purification, and functional assays

    • Use consistent assay conditions, cell lines, and reagent sources

    • Implement quality control checkpoints (e.g., expression verification, functional validation with known ligands)

  • Addressing Experimental Variability:

    • Identify sources of variability (cell passage, transfection efficiency, etc.)

    • Implement internal controls to normalize data between experiments

    • Use statistical approaches that account for both biological and technical variability

  • Reconciling Contradictory Results:

    • Compare methodological details between studies reporting contradictory findings

    • Consider differences in receptor constructs (tags, mutations, species variants)

    • Evaluate differences in assay systems and their potential impact on receptor function

    • Directly test hypotheses about the sources of contradictions through controlled experiments

  • Bioinformatic Approaches:

    • Implement pathway analysis (PA) techniques to integrate data from multiple sources

    • Use master regulators analysis to identify key factors that may influence receptor function across different experimental systems

    • Apply meta-analysis approaches to synthesize findings across multiple studies

  • Collaborative Verification:

    • Establish collaborations to independently verify key findings using standardized protocols

    • Participate in multi-laboratory studies to identify robust and reproducible aspects of OR1L1 function

    • Share reagents (stable cell lines, purified proteins) to reduce technical variability between labs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.