Recombinant Human Olfactory receptor 1L8 (OR1L8)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Olfactory Receptor 1L8 (OR1L8) is a genetically engineered variant of the olfactory receptor protein encoded by the OR1L8 gene in humans. This receptor belongs to the class A G-protein-coupled receptor (GPCR) family and plays a role in odorant detection by initiating neuronal signaling in response to specific odor molecules . Recombinant OR1L8 is produced in heterologous expression systems to study its structural, functional, and ligand-binding properties, enabling advances in olfactory research and therapeutic applications .

Production and Purification

Recombinant OR1L8 is synthesized using various expression systems:

ParameterDetails
Expression SystemE. coli , HEK293S (tetracycline-inducible)
TagsHis-tag (N-terminal), FLAG-tag (N-terminal), rho1D4-tag (C-terminal)
PurificationAnti-FLAG immunoaffinity chromatography, size-exclusion chromatography
Yield1.6 mg (monomer) and 1.1 mg (dimer) from 60 T175 flasks
Storage-20°C (short-term), -80°C (long-term); avoid repeated freeze-thaw cycles

Ligand Binding

  • Primary Ligand: Dihydrojasmone, a floral odorant, binds OR1L8 with micromolar affinity (KdμK_d \approx \muM range) as shown by tryptophan fluorescence assays .

  • Mechanism: Ligand binding induces conformational changes, activating Golf_\text{olf} proteins and downstream cAMP signaling .

Oligomerization

  • Recombinant OR1L8 exists in monomeric and dimeric forms, confirmed by size-exclusion chromatography with multi-angle light scattering (SEC-MALS) .

Sensitivity Thresholds

  • Single olfactory receptors like OR1L8 determine odor detection thresholds, with sensitivity influenced by ligand concentration and receptor-ligand affinity .

Research Applications

  1. Structural Biology: Purified OR1L8 enables crystallographic and NMR studies to resolve GPCR activation mechanisms .

  2. Ligand Screening: Used in high-throughput assays to identify novel odorants or modulators .

  3. Diagnostic Tools: Commercial ELISA kits (e.g., Abbexa A16368) quantify OR1L8 in biological samples .

  4. Functional Studies: Real-time cAMP assays in HEK293S cells validate receptor activity .

Challenges and Future Directions

  • Expression Limitations: Low yields in heterologous systems necessitate optimized protocols .

  • Ligand Diversity: OR1L8’s broad ligand selectivity requires advanced screening platforms like M2OR, a database of OR-odorant pairs .

  • Therapeutic Potential: ORs are explored for roles in non-olfactory tissues (e.g., prostate, airway), suggesting diagnostic or therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
OR1L8; Olfactory receptor 1L8; Olfactory receptor OR9-24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR1L8
Target Protein Sequence
MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLLIILAIRFNPHLQTPM YFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYFLYALGNSDSCLLAVMA FDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLLLNRLTFCDSNVIHHFLC DLSPVLKLSCSSIFVNEIVQMTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFS TCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVLSSMLNPFIYSLRNKDLKQG LRKLMSKRS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15110

KEGG: hsa:138881

STRING: 9606.ENSP00000306607

UniGene: Hs.632695

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR1L8 and what is its primary function?

OR1L8 (olfactory receptor family 1 subfamily L member 8) is a 35.1 kDa protein consisting of 309 amino acids that functions as an odorant receptor . It belongs to the G-protein-coupled receptor (GPCR) family and is primarily involved in the recognition and transduction of olfactory signals that initiate the perception of smell . Like other olfactory receptors, OR1L8 interacts with specific odorant molecules in the nasal epithelium to trigger neuronal responses that are ultimately interpreted by the brain as distinct odors . The protein is encoded by a single coding-exon gene and shares the characteristic 7-transmembrane domain structure common to many neurotransmitter and hormone receptors .

What is the genomic context of OR1L8?

OR1L8 is located on chromosome 9 at position 9q33.2 (NC_000009.12, complement position 122546271..122583384) . The gene contains a total of 6 exons, which is notable as many olfactory receptor genes typically consist of a single coding exon . OR1L8 is also known by the alternative designation OR9-24 . As part of the olfactory receptor gene family, it belongs to the largest gene family in the human genome, highlighting the evolutionary importance of olfaction in vertebrates .

How do olfactory receptors like OR1L8 determine odor detection thresholds?

Research on olfactory receptors has demonstrated that behavioral sensitivity to odors is determined by the most sensitive receptor rather than a pooling of inputs from multiple receptors of varying sensitivity . This finding supports a "lower envelope" model of olfactory detection, where the threshold is dictated solely by the most sensitive afferents . In studies with trace amine-associated receptors (TAARs), researchers found that deleting the highest affinity receptor altered behavioral threshold, indicating that threshold depends on the most sensitive receptor . While these studies specifically examined TAARs rather than OR1L8, the principles likely apply across olfactory receptor types, suggesting that OR1L8's sensitivity to its cognate odorants would similarly contribute to detection thresholds for those specific compounds.

What techniques are effective for studying OR1L8 expression and function?

Several methodological approaches have proven valuable for investigating olfactory receptors:

  • DREAM (Drop of Expression After Mating) Assay: This technique identifies receptor-ligand pairs in vivo by measuring odor-evoked reduction in the expression of activated receptor genes . The protocol involves exposing mice to odorants for 24 hours, followed by RNA extraction from the olfactory epithelium and qPCR analysis to measure changes in receptor gene expression .

  • Recombinant Protein Expression: Full-length recombinant proteins can be produced in cell-free systems to achieve ≥85% purity, suitable for SDS-PAGE analysis and functional studies . While this information comes from work with a different olfactory receptor (5AL1), similar approaches could be applied to OR1L8.

  • Genetic Modification Techniques: Transgenic approaches can be used to overexpress receptors or create knockout models to study the effects on olfactory sensitivity and behavior . For example, researchers have used gene deletion and overexpression to investigate how receptor expression levels affect odor detection thresholds .

What challenges exist in expressing functional recombinant OR1L8 for structural and biochemical studies?

Production of functional olfactory receptors presents several technical challenges that researchers must address:

  • Membrane Protein Expression: As a 7-transmembrane domain protein, OR1L8 is difficult to express in conventional systems due to issues with proper folding, membrane insertion, and potential toxicity to host cells.

  • Post-translational Modifications: Ensuring proper glycosylation and other modifications that may be essential for function requires careful selection of expression systems.

  • Functional Assays: Developing reliable assays to confirm that recombinant OR1L8 maintains its native odorant-binding properties and signaling capabilities is critical for meaningful studies.

  • Purification Challenges: Obtaining sufficient quantities of pure, homogeneous, and stable protein for structural studies requires optimization of detergents and buffer conditions.

Cell-free expression systems have shown promise for producing full-length olfactory receptor proteins with high purity (≥85%) , suggesting this approach might be valuable for OR1L8 studies. The successful expression of recombinant olfactory receptor 5AL1 in such systems provides a potential methodological framework for OR1L8 expression .

How can genetic variations in OR1L8 be studied in relation to olfactory perception?

Investigating the impact of OR1L8 genetic variations on olfactory perception requires a multi-faceted approach:

  • Genomic Analysis: Identifying single nucleotide polymorphisms (SNPs) and other variations in the OR1L8 gene across populations using databases like Variation Viewer and ClinVar .

  • Functional Characterization: Expressing variant forms of OR1L8 in heterologous systems to assess changes in ligand specificity, sensitivity, or signaling efficiency.

  • Psychophysical Testing: Correlating genetic variants with differences in odor perception through controlled human studies, similar to approaches that have revealed correlations between OR polymorphisms and variability in odor perception .

  • Structural Modeling: Using computational approaches to predict how specific mutations might affect the protein's structure and function, particularly in the ligand-binding pocket.

Previous human studies have demonstrated that polymorphisms in single OR genes correlate with variability in odor perception , suggesting that genetic variations in OR1L8 could similarly influence specific olfactory sensitivities in humans.

What is the potential role of OR1L8 in neurological disorders such as neuronitis?

OR1L8 has been implicated in research related to neuronitis, suggesting potential connections between this olfactory receptor and neurological disorders . Several investigative approaches could elucidate this relationship:

  • Expression Analysis: Comparing OR1L8 expression levels in olfactory tissues from healthy individuals versus those with neuronitis or other neurological conditions.

  • Animal Models: Developing OR1L8 knockout or overexpression models to observe effects on neural development, function, and response to inflammatory stimuli.

  • Clinical Correlation Studies: Assessing whether specific OR1L8 variants are more prevalent in patients with certain neurological disorders.

  • Signaling Pathway Investigation: Determining if aberrant OR1L8 signaling through its interactions with GNAL, OR4D11, OR52E6, GNGT1, and OR10A3 contributes to neurological pathologies .

Understanding this relationship could provide insights into both the pathophysiology of neuronitis and the broader roles of olfactory receptors beyond their canonical function in odor detection.

How does the sensitivity of OR1L8 compare to other olfactory receptors, and what determines these differences?

  • Receptor Hierarchy: Different receptors exhibit varying sensitivities to the same odorant, creating a hierarchy of response thresholds . For example, TAAR4 was identified as the most sensitive receptor for phenylethylamine, followed by TAAR3 .

  • Concentration-Dependent Activation: At lower concentrations, only the most sensitive receptor (e.g., TAAR4 for phenylethylamine) may be activated, while at higher concentrations, additional receptors (e.g., TAAR3) become engaged .

  • Structural Determinants: Sensitivity differences likely stem from variations in binding pocket architecture that affect ligand affinity.

For OR1L8 specifically, determining its relative sensitivity would require direct comparisons with other receptors using techniques like the DREAM assay or electrophysiological recordings from expressing cells. Such comparative studies would reveal OR1L8's position within the sensitivity hierarchy for its cognate odorants.

What are the optimal approaches for identifying OR1L8 ligands?

Identifying the specific odorants that activate OR1L8 requires systematic screening approaches:

  • DREAM Assay Application: Adapting the DREAM assay methodology to specifically target OR1L8 would allow in vivo identification of potential ligands . This would involve exposing test subjects to various odorants and measuring changes in OR1L8 expression through qPCR analysis .

  • Heterologous Expression Systems: Expressing OR1L8 in cell lines along with reporter systems that measure calcium flux, cAMP production, or other second messengers to screen compound libraries.

  • Computational Prediction: Using molecular docking and machine learning approaches to predict potential ligands based on the receptor's binding pocket characteristics and known ligands of related receptors.

  • Structure-Activity Relationship Studies: Once initial ligands are identified, testing structural analogs to determine the chemical features critical for OR1L8 activation.

These methods can be combined in an iterative process to build a comprehensive profile of OR1L8's odor response spectrum.

How can researchers overcome the limitations of OR1L8 overexpression systems?

Studies on olfactory receptors have revealed important considerations for overexpression systems:

  • Sensitivity vs. Expression Level: Interestingly, research has shown that increasing the number of OSNs expressing a specific olfactory receptor (through transgenic overexpression) does not necessarily enhance behavioral sensitivity to that receptor's cognate odorants . In studies with TAAR4, a 12-fold increase in OSN number and 7-fold increase in glomeruli did not improve detection thresholds .

  • Maintaining Physiological Relevance: When designing overexpression systems for OR1L8, researchers should consider that the goal may not be to increase sensitivity but rather to facilitate detection and characterization of the receptor's properties.

  • Alternative Approaches: Rather than focusing solely on increasing expression levels, researchers might benefit from improving receptor trafficking to the cell surface, enhancing coupling to signaling components, or reducing background activity in heterologous systems.

  • Convergence Considerations: The convergence ratio between olfactory sensory neurons and their downstream targets (mitral/tufted cells) may be an important factor in sensitivity models . Experimental designs should consider this aspect of neural circuitry when interpreting results from overexpression systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.