Recombinant Human Olfactory receptor 2A1/2A42 (OR2A1)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

OR2A1 belongs to the olfactory receptor family 2 subfamily A, encoded by the OR2A1 gene on chromosome 7. As a Class A G-protein-coupled receptor (GPCR), it features a seven-transmembrane domain structure critical for odorant recognition and signal transduction . The recombinant form typically includes epitope tags (e.g., FLAG or rho1D4) to facilitate purification and detection .

PropertyDetails
Molecular Weight34.7 kDa
Gene ID346528 (NCBI)
Protein FamilyG-protein-coupled receptor 1
Key DomainsExtracellular odorant-binding region; transmembrane helices; C-terminal tail

Production and Purification

Recombinant OR2A1 is synthesized using heterologous expression systems:

  • Escherichia coli: Utilized for cost-effective, high-yield production of fragment proteins .

  • HEK293S Cells: Employed for full-length, post-translationally modified receptors, often via tetracycline-inducible systems .

  • Wheat Germ: Used for producing soluble fragments (e.g., residues 261–318) suitable for ELISA and Western blot .

Purification involves affinity chromatography (e.g., anti-FLAG resins) followed by gel filtration, yielding monomeric and dimeric forms . Typical yields reach 1.6 mg (monomer) and 1.1 mg (dimer) per 60 T175 flasks .

Ligand Binding Studies

  • Fluorescence Assays: Intrinsic tryptophan fluorescence measurements demonstrate micromolar-affinity binding to odorants like dihydrojasmone .

  • High-Throughput Screening: Integrated into databases like M2OR, which catalogs 51,395 OR-odorant pairs and 75,050 bioassays .

Therapeutic Exploration

  • Although OR2A1 itself is not directly targeted in therapies, related olfactory receptors (e.g., OR2H1) are investigated for CAR T-cell cancer treatments due to tumor-specific expression .

Challenges and Future Directions

While recombinant OR2A1 enables odorant interaction mapping, obstacles persist:

  • Low Solubility: Requires detergent solubilization, which may alter native conformation .

  • Ligand Diversity: Only ~6% of tested OR-odorant pairs show activity in databases like M2OR .
    Future work aims to crystallize OR2A1 for atomic-resolution insights and expand ligand libraries using machine learning .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR2A1; OR2A42; Olfactory receptor 2A1/2A42; Olfactory receptor OR7-16; Olfactory receptor OR7-19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2A1;
Target Protein Sequence
MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYF FLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYD RYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEI LSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL RRALGKESHS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8229

KEGG: hsa:346528

STRING: 9606.ENSP00000386175

UniGene: Hs.528398

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Olfactory Receptor 2A1/2A42 and what family does it belong to?

Recombinant Human Olfactory Receptor 2A1/2A42 (OR2A1/2A42) is an odorant receptor that belongs to the G-protein coupled receptor 1 family . It functions as a chemosensory receptor that detects odorant molecules in the olfactory epithelium. The receptor is typically available as a recombinant protein for research purposes, with human fragments expressed in expression systems such as wheat germ . As a G-protein coupled receptor, it features the characteristic seven-transmembrane domain structure and couples with G-proteins to initiate intracellular signaling cascades upon odorant binding.

What are the common synonyms and alternative nomenclature for OR2A1/2A42?

OR2A1/2A42 is referenced in scientific literature under several alternative names:

Official NameAlternative Nomenclature
OR2A1Olfactory receptor 2A1
OR2A42Olfactory receptor 2A42
OR2A1/2A42Olfactory receptor 2A1/2A42
OR7-16Olfactory receptor OR7-16
OR7-19Olfactory receptor OR7-19

Additionally, related receptors include OR2A17P, OR2A2P, OR2A2, and Olfactory receptor OR7-11 . Researchers should verify the exact receptor identity when comparing literature to ensure consistent interpretation of results.

What is the molecular weight and key structural properties of OR2A1/2A42?

OR2A1/2A42 has a molecular weight of approximately 34 kDa . Available recombinant forms may represent specific amino acid ranges of the complete protein. For example, commercial recombinant fragments may encompass regions such as amino acids 241-290 or 261-318 . The full sequence typically includes conserved regions characteristic of the G-protein coupled receptor family, including seven transmembrane domains connected by intracellular and extracellular loops. Researchers should consider which specific protein regions are most suitable for their experimental needs, particularly when designing targeted studies of receptor function.

What expression systems are recommended for producing recombinant OR2A1/2A42?

For recombinant expression of OR2A1/2A42, wheat germ cell-free expression systems have proven successful as demonstrated in commercially available products . This approach offers advantages for expressing mammalian membrane proteins that may be difficult to produce in bacterial systems.

When designing your expression system protocol, consider:

  • Cell-free systems often yield correctly folded protein more efficiently than bacterial systems for GPCRs

  • Codon optimization for the expression system may improve yields

  • Addition of appropriate tags for purification and detection

  • Inclusion of chaperones or receptor transporting proteins may improve functional expression

For validation experiments, it's advisable to compare expression patterns with known positive controls for olfactory receptors to confirm proper folding and trafficking.

What experimental applications is recombinant OR2A1/2A42 suitable for?

Recombinant OR2A1/2A42 can be utilized in multiple experimental applications:

ApplicationRecommended DilutionsNotes
Western Blotting (WB)1:500-1000For protein detection and quantification
Immunofluorescence (IF)1:50-200For cellular localization studies
ELISA1:5000For quantitative detection and protein interaction studies

When designing experiments, consider appropriate controls, including:

  • Positive controls using known OR2A1/2A42-expressing tissues

  • Negative controls using tissues that don't express olfactory receptors

  • Isotype controls when using antibodies to detect the recombinant protein

Validation of experimental results across multiple techniques is recommended due to potential cross-reactivity with related olfactory receptors.

How should researchers design studies to investigate OR2A1/2A42 trafficking and localization?

When investigating OR2A1/2A42 trafficking and localization, a comprehensive experimental design should include:

  • Fluorescently-tagged OR2A1/2A42 constructs for live-cell imaging

  • Co-expression with receptor transporting proteins (RTPs) to assess their role in trafficking

  • Immunofluorescence using specific antibodies at recommended dilutions (1:50-200)

  • Subcellular fractionation followed by Western blotting to quantify receptor distribution

Research has established that receptor transporting proteins play a crucial role in olfactory receptor trafficking to the cell surface . When designing trafficking studies, include experimental groups that compare wild-type conditions with RTP knockout or knockdown conditions to assess the dependence of OR2A1/2A42 on these accessory proteins. Time-course experiments are also valuable for determining trafficking kinetics from the endoplasmic reticulum to the plasma membrane.

How do receptor transporting proteins (RTPs) affect OR2A1/2A42 expression and function?

Receptor transporting proteins (RTPs), particularly RTP1 and RTP2, play crucial roles in olfactory receptor trafficking and expression patterns . Studies using RTP1 and RTP2 double knockout mice (RTP1,2DKO) revealed that:

  • The absence of RTPs leads to OR trafficking defects and decreased olfactory sensory neuron (OSN) activation

  • Approximately 50% of olfactory receptors are underrepresented in RTP1,2DKO mice

  • Surprisingly, about 10% of ORs (overrepresented ORs or oORs) show increased expression in RTP1,2DKO mice

When designing experiments to investigate RTP effects on OR2A1/2A42 specifically, researchers should:

  • Determine whether OR2A1/2A42 requires RTPs for surface expression or can traffic independently

  • Assess whether OR2A1/2A42 expression changes in RTP-deficient conditions

  • Investigate if OR2A1/2A42 falls into the underrepresented or overrepresented category in absence of RTPs

Understanding the dependence of OR2A1/2A42 on RTP machinery provides insight into its trafficking mechanism and may explain expression patterns observed in various experimental conditions .

What methods can be used to resolve contradictory data regarding OR2A1/2A42 function?

When encountering contradictory results in OR2A1/2A42 research, consider implementing these methodological approaches:

  • Conduct heterologous expression studies: Express OR2A1/2A42 in cell lines both with and without RTP co-expression to determine if trafficking differences explain functional discrepancies

  • Compare cell surface expression levels: Quantify surface expression using:

    • Cell surface biotinylation followed by pull-down and immunoblotting

    • Flow cytometry with antibodies targeting extracellular epitopes

    • Surface ELISA assays

  • Implement controlled ligand screening:

    MethodPurposeControls
    Calcium imagingDetect activation upon ligand bindingInclude known olfactory receptor ligands as positive controls
    cAMP assaysMeasure downstream signalingInclude forskolin as positive control for cAMP production
    Receptor internalizationAssess ligand-induced endocytosisCompare to constitutive internalization rates
  • Cross-validate with knockout models: Generate or utilize OR2A1/2A42 knockout models to confirm specificity of observed phenotypes

How can unfolded protein response (UPR) measurements be incorporated into OR2A1/2A42 research?

Research has revealed an important link between OR trafficking, unfolded protein response (UPR), and OR gene choice in olfactory sensory neurons . To incorporate UPR measurements into OR2A1/2A42 studies:

  • Monitor UPR markers in OR2A1/2A42-expressing cells:

    • Assess BiP/GRP78 levels via Western blotting or immunofluorescence

    • Measure XBP1 splicing through RT-PCR

    • Quantify ATF6 nuclear translocation via immunofluorescence

    • Analyze PERK phosphorylation status

  • Design co-expression experiments:

    • Co-express OR2A1/2A42 with nATF5 (a marker of UPR in OSNs)

    • Compare UPR activation between wild-type and RTP1,2-deficient conditions

    • Include both efficiently and poorly trafficking ORs as controls

  • Establish timeline experiments:

    • Track the temporal relationship between OR2A1/2A42 expression, UPR activation, and cell maturation or death

    • Use pulse-chase experiments to determine protein stability and trafficking efficiency

This methodological approach allows researchers to determine whether OR2A1/2A42 triggers UPR when expressed without necessary trafficking proteins, and whether successful trafficking correlates with UPR resolution . Such information provides insight into how OR2A1/2A42 might influence OSN survival and maturation in the olfactory epithelium.

What are the optimal storage and handling conditions for OR2A1/2A42 antibodies and recombinant proteins?

For maintaining optimal activity of OR2A1/2A42 antibodies and recombinant proteins:

Reagent TypeStorage TemperatureBuffer CompositionShelf LifeSpecial Considerations
Polyclonal Antibodies-20°CPBS with 0.02% sodium azide and 50% glycerol, pH 7.41 yearAvoid repeated freeze-thaw cycles
Recombinant Proteins-80°C for long-term; -20°C for working aliquotsApplication-dependent buffer6-12 monthsStore in small single-use aliquots

When handling these reagents:

  • Thaw frozen aliquots on ice

  • Centrifuge briefly before opening tubes to collect contents

  • Use sterile technique to prevent contamination

  • For antibodies, avoid exposure to light if conjugated to fluorophores

  • Return to recommended storage conditions immediately after use

Proper storage and handling significantly impact experimental reproducibility and reagent longevity .

What controls should be included when designing OR2A1/2A42 expression experiments?

A robust experimental design for OR2A1/2A42 expression studies should include the following controls:

  • Positive expression controls:

    • Known OR2A1/2A42-expressing tissues (olfactory epithelium)

    • Cell lines with confirmed OR2A1/2A42 expression

  • Negative controls:

    • Tissues that don't express olfactory receptors

    • Cell lines transfected with empty vector

    • OR2A1/2A42 knockout or knockdown samples

  • Technical controls:

    • Secondary antibody-only controls for immunodetection

    • Loading controls for Western blots (β-actin, GAPDH)

    • Housekeeping gene controls for RT-qPCR (verified to be stable under experimental conditions)

  • Trafficking controls:

    • Co-expression with and without RTPs

    • Intracellular markers for endoplasmic reticulum (calnexin, PDI)

    • Membrane markers (Na+/K+ ATPase)

These controls help distinguish specific OR2A1/2A42 signals from background and ensure accurate interpretation of experimental results, particularly when working with low-abundance proteins like olfactory receptors .

How can OR2A1/2A42 be utilized in studies of olfactory system development?

OR2A1/2A42 offers valuable research opportunities for studying olfactory system development, particularly regarding the phenomenon of "one neuron-one receptor" expression patterns. Research design should consider:

  • Developmental time-course experiments:

    • Track OR2A1/2A42 expression at different embryonic and postnatal stages

    • Correlate expression with OSN maturation markers

    • Compare with the developmental patterns of other ORs

  • Gene choice mechanisms:

    • Utilize OR2A1/2A42 promoter-reporter constructs to visualize expression dynamics

    • Investigate factors that influence the probability of OR2A1/2A42 being chosen over other ORs

    • Compare RTP-dependent vs. independent trafficking to understand selective pressure

  • Methodological approaches:

    • Single-cell RNA sequencing to capture the heterogeneity of OR expression

    • In situ hybridization combined with immunohistochemistry for spatial resolution

    • CRISPR-based lineage tracing to follow the fate of OR2A1/2A42-expressing cells

This research framework builds on findings that protein trafficking efficiency influences gene choice stability in developing OSNs, potentially explaining why some ORs (like OR2A1/2A42) might be expressed at different frequencies in the olfactory epithelium .

What are the methodological considerations when studying OR2A1/2A42 in the context of the unfolded protein response (UPR)?

When investigating the relationship between OR2A1/2A42 and the unfolded protein response, researchers should implement these methodological considerations:

  • Experimental design elements:

    • Compare OR2A1/2A42-expressing cells with and without RTPs to modulate trafficking efficiency

    • Include time-course measurements to capture the dynamic nature of the UPR

    • Distinguish between adaptive and terminal UPR responses

  • UPR measurement techniques:

    UPR BranchMeasurement MethodExpected Outcome
    PERKWestern blot for phospho-PERKIncreased in cells with ER-retained OR2A1/2A42
    IRE1RT-PCR for XBP1 splicingHigher spliced/unspliced ratio with trafficking defects
    ATF6Nuclear fractionation and immunoblottingNuclear enrichment with ER stress
    DownstreamqPCR for CHOP, BiP, GADD34Upregulation indicates active UPR
  • Co-expression strategies:

    • Express OR2A1/2A42 with fluorescent UPR reporters

    • Co-express with nATF5 to assess correlation with UPR activation

    • Use ER stress inducers (tunicamycin, thapsigargin) as positive controls

This methodological approach allows researchers to determine whether OR2A1/2A42 activates the UPR when inefficiently trafficked, and how this activation might influence OSN survival and OR gene choice stability .

What statistical approaches are most appropriate for analyzing OR2A1/2A42 expression data in complex tissue samples?

When analyzing OR2A1/2A42 expression in complex tissues like the olfactory epithelium, robust statistical approaches are essential:

  • For RNA-Seq data analysis:

    • Apply FDR-corrected p-values for differential expression analysis

    • Use specialized tools for low-abundance transcripts like olfactory receptors

    • Consider the compositional nature of RNA-Seq data when comparing expression levels across samples

  • For quantitative cell counting:

    • Apply Fisher's exact test for comparing proportions of OR2A1/2A42-expressing cells between conditions

    • Use appropriate multiple testing corrections when comparing across multiple ORs

    • Consider spatial distribution using nearest-neighbor analysis

  • For co-expression analysis:

    • Implement contingency table analysis for co-expression with markers like nATF5

    • Use bootstrap resampling to establish confidence intervals for co-expression rates

    • Apply Bayesian approaches to account for technical variation in detection sensitivity

  • Recommended sample sizes:

    Analysis TypeMinimum Sample SizePower Calculation Considerations
    RNA-Seq3-6 biological replicatesAccount for high OR-to-OR variability
    Cell Counting>100 cells per conditionBased on expected frequency of OR2A1/2A42 expression
    Co-expression>50 co-expressing cellsDependent on co-expression probability

These statistical approaches address the unique challenges of olfactory receptor research, including low expression levels, high variability, and the sparse nature of OR expression in the olfactory epithelium .

What are common challenges in detecting OR2A1/2A42 expression and how can they be overcome?

Researchers frequently encounter several challenges when detecting OR2A1/2A42:

  • Low expression levels:

    • Solution: Use sensitive detection methods such as nested PCR, RNAscope, or digital droplet PCR

    • Implement signal amplification techniques for immunodetection (tyramide signal amplification)

    • Consider enrichment of OR2A1/2A42-expressing cells through FACS or laser capture microdissection

  • Antibody specificity issues:

    • Solution: Validate antibodies using knockout controls or peptide competition assays

    • Test multiple antibodies targeting different epitopes

    • Confirm protein detection with orthogonal methods (mass spectrometry)

  • ER retention without trafficking assistance:

    • Solution: Co-express with RTP1/2 to improve surface trafficking

    • Use permeabilization protocols that access intracellular compartments

    • Include markers for subcellular compartments to identify retention sites

  • Quality control measures:

    IssueQuality Control ApproachExpected Result
    Antibody specificityWestern blot on recombinant proteinSingle band at 34 kDa
    Surface expressionCell surface biotinylationEnrichment in biotinylated fraction with RTP co-expression
    mRNA detectionRT-PCR with transcript-specific primersAmplification only in OR2A1/2A42 expressing tissues

Implementing these methodological solutions significantly improves detection reliability and experimental reproducibility when working with challenging proteins like OR2A1/2A42 .

How does OR2A1/2A42 compare structurally and functionally to other olfactory receptors?

When conducting comparative analyses of OR2A1/2A42 with other olfactory receptors, consider these methodological approaches:

  • Sequence-based comparisons:

    • Perform multiple sequence alignments focusing on transmembrane domains

    • Identify conserved motifs that may indicate functional importance

    • Calculate evolutionary distances to reconstruct phylogenetic relationships

  • Trafficking efficiency comparisons:

    • Express OR2A1/2A42 alongside other ORs with and without RTPs

    • Quantify surface expression levels using consistent methodologies

    • Determine if OR2A1/2A42 belongs to the RTP-dependent (uOR) or RTP-independent (oOR) group

  • Expression pattern analysis:

    • Compare zonal distribution in the olfactory epithelium

    • Assess developmental expression timing

    • Quantify the number of OSNs expressing OR2A1/2A42 versus other ORs in the same zone

  • Recommended comparative framework:

    FeatureOR2A1/2A42Typical uORsTypical oORs
    RTP Dependence(to be determined)StrongMinimal
    Cell Surface Expression(to be determined)Poor without RTPsRobust without RTPs
    UPR Activation(to be determined)High without RTPsLow without RTPs

This methodological framework enables researchers to position OR2A1/2A42 within the spectrum of olfactory receptor behaviors and potentially identify unique functional or structural characteristics that distinguish it from other family members .

What experimental approaches can determine if OR2A1/2A42 requires RTPs for efficient trafficking?

To experimentally determine whether OR2A1/2A42 requires receptor transporting proteins for efficient trafficking:

  • Heterologous expression system experiments:

    • Express OR2A1/2A42 in cell lines (HEK293, HeLa) with and without RTP1/2

    • Quantify surface expression using:
      a. Surface biotinylation followed by Western blotting
      b. Flow cytometry with antibodies against extracellular epitopes
      c. Immunofluorescence with non-permeabilized cells

  • Trafficking dynamics assessment:

    • Create fluorescently-tagged OR2A1/2A42 constructs

    • Perform live-cell imaging to track trafficking kinetics

    • Compare ER exit rates with and without RTP co-expression

  • In vivo approaches:

    • Compare OR2A1/2A42 expression patterns in wild-type versus RTP1,2DKO mice

    • Determine if OR2A1/2A42 falls into the underrepresented (uOR) or overrepresented (oOR) category in knockout mice

    • Assess co-expression with UPR markers like nATF5 in both genotypes

Based on current research on other olfactory receptors, if OR2A1/2A42 is RTP-dependent, you would expect reduced surface expression, increased ER retention, and elevated UPR markers when expressed without RTPs . Conversely, if it's RTP-independent, it would show robust surface expression regardless of RTP co-expression and potentially increased representation in RTP1,2DKO mice.

How can OR2A1/2A42 research contribute to understanding the principles of "one neuron-one receptor" expression?

OR2A1/2A42 offers a valuable model system for investigating the fundamental principle of singular olfactory receptor expression in OSNs:

  • Experimental approaches to determine OR2A1/2A42 selection mechanisms:

    • Create OR2A1/2A42 promoter reporter constructs to visualize selection dynamics

    • Compare selection frequencies between wild-type and RTP-deficient backgrounds

    • Investigate epigenetic modifications at the OR2A1/2A42 locus during OSN development

  • Methodological framework for studying gene choice:

    • Single-cell RNA-seq to capture transitional states during OR selection

    • Lineage tracing to follow the fate of OSNs initially expressing OR2A1/2A42

    • Perturbation experiments altering OR2A1/2A42 trafficking efficiency

  • Mechanistic investigation of feedback mechanisms:

    • Determine if efficient OR2A1/2A42 trafficking correlates with downregulation of UPR

    • Assess if surface expression leads to activation of signals that stabilize gene choice

    • Compare with ORs that show different trafficking dependencies

Evidence suggests that proper trafficking of ORs to the cell surface plays a crucial role in establishing stable OR gene choice . By determining whether OR2A1/2A42 trafficking efficiency influences its selection frequency and stability, researchers can gain insights into the mechanisms underlying the remarkable specificity of OR expression in the olfactory system.

What experimental design would best investigate the relationship between OR2A1/2A42 trafficking and OSN survival?

To investigate the relationship between OR2A1/2A42 trafficking and OSN survival, implement this comprehensive experimental design:

  • In vitro cell survival assessment:

    • Express OR2A1/2A42 in heterologous cells with and without RTPs

    • Monitor cell viability using multiple assays (MTT, TUNEL, Annexin V)

    • Correlate trafficking efficiency with apoptotic markers

  • In vivo developmental analysis:

    • Generate OSNs expressing OR2A1/2A42 with trafficking modifications

    • Track cell survival over developmental time points

    • Compare with OSNs expressing known uORs and oORs

  • UPR pathway examination:

    Experimental GroupExpected UPR StatusExpected Survival Outcome
    OR2A1/2A42 + RTPsResolved UPREnhanced survival
    OR2A1/2A42 without RTPsSustained UPR (if RTP-dependent)Increased apoptosis
    OR2A1/2A42 mutated for improved traffickingReduced UPRImproved survival regardless of RTPs
  • Comparative survival analysis:

    • Compare survival rates between OSNs expressing OR2A1/2A42 versus other ORs

    • Assess whether RTP-independence correlates with improved survival

    • Determine if survival advantages translate to overrepresentation in the mature olfactory epithelium

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.