Recombinant Human Olfactory receptor 2A12 (OR2A12)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

OR2A12 belongs to the class A G protein-coupled receptor (GPCR) family and is encoded by the OR2A12 gene. Key characteristics include:

PropertyDetails
Gene SymbolOR2A12 (Olfactory Receptor Family 2 Subfamily A Member 12)
UniProt IDQ8NGT7
Protein ClassClass A GPCR (rhodopsin-like)
SubfamilyClass II (tetrapod-specific receptors)
Tissue ExpressionPrimarily olfactory epithelium; limited data on extranasal expression

Odorant Recognition

  • OR2A12 likely detects hydrophobic odorants due to its classification under class II ORs .

  • No deorphanization studies (identification of activating ligands) are reported in literature or databases (M2OR, PubMed) .

Recombinant Expression

  • Production Systems: Similar ORs (e.g., OR2A2) are expressed in heterologous systems like HEK293 or wheat germ (e.g., residues 261–318 for OR2A2) .

  • Chaperone Requirements: Co-expression with RTP1S/RTP2 and Ric-8B enhances surface localization and functionality .

Research Gaps and Challenges

  • Ligand Specificity: Unlike OR51E2 or OR1D2, no activating ligands or antagonists are documented for OR2A12 .

  • Physiological Roles: While some ORs function in sperm chemotaxis or tissue homeostasis, OR2A12’s extranasal roles remain unexplored .

  • Structural Studies: Requires cryo-EM or X-ray crystallography to resolve activation mechanisms, as done for OR51E2 .

Comparative Data

FeatureOR2A12OR51E2 (Benchmark OR)
Ligands IdentifiedNonePropionate, short-chain fatty acids
Structural DataHomology models onlyCryo-EM resolved
Expression SystemWheat germ (hypothetical)HEK293 with chaperones

Potential Applications

  • Biosensors: Integration into cell arrays for odor profiling, akin to OR2A2 in human OR sensor platforms .

  • Drug Discovery: Targeting ORs for metabolic or neurological disorders, pending ligand identification .

References

  • UniProt entry Q8NGT7 provides basic gene/protein annotations .

  • M2OR database catalogs OR-ligand pairs but lacks OR2A12 entries .

  • Structural insights from OR51E2 studies inform mechanistic hypotheses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format in your order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
OR2A12; OR2A12P; Olfactory receptor 2A12; Olfactory receptor OR7-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2A12
Target Protein Sequence
MESNQTWITEVILLGFQVDPALELFLFGFFLLFYSLTLMGNGIILGLIYLDSRLHTPMYV FLSHLAIVDMSYASSTVPKMLANLVMHKKVISFAPCILQTFLYLAFAITECLILVMMCYD RYVAICHPLQYTLIMNWRVCTVLASTCWIFSFLLALVHITLILRLPFCGPQKINHFFCQI MSVFKLACADTRLNQVVLFAGSAFILVGPLCLVLVSYLHILVAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLFYSLFNPILNPLIYSLRNAEVKGAL KRVLWKQRSM
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15082

KEGG: hsa:346525

STRING: 9606.ENSP00000386174

UniGene: Hs.553708

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2A12 and what is its primary function?

OR2A12 (Olfactory Receptor Family 2 Subfamily A Member 12) is a G protein-coupled receptor belonging to the olfactory receptor family. It functions primarily in the detection of chemical stimuli involved in the sensory perception of smell. As with other olfactory receptors, OR2A12 is expressed on the surface of olfactory sensory neurons and participates in the combinatorial coding of odors by interacting with specific odorant molecules . Structurally, it belongs to the G-protein coupled receptor 1 family, containing the characteristic seven-transmembrane domain architecture typical of this receptor class .

What is the expression profile of OR2A12 across human tissues?

OR2A12 shows a distinctive expression pattern across various human tissues. According to transcriptomic data, it demonstrates highest expression in the thymus (33% coverage, 0.92 average TPM across 217 samples), followed by notable expression in ovary (18% coverage, 0.44 TPM), pancreas (18% coverage, 0.39 TPM), and breast tissue (18% coverage, 0.47 TPM) . The receptor also shows moderate expression in prostate, skin, lung, and kidney tissues. This expression pattern suggests potential functions beyond the canonical olfactory system, which merits further investigation in research settings focused on these specific tissues.

How is recombinant OR2A12 typically produced for research purposes?

Recombinant OR2A12 for research applications is commonly produced using heterologous expression systems. Based on similar olfactory receptor production methods, wheat germ cell-free expression systems have proven effective for producing functional olfactory receptor proteins . This approach circumvents challenges associated with membrane protein expression in conventional systems. The recombinant protein is typically generated as a fragment (similar to other olfactory receptors which may be produced in the 261-318 amino acid range) and purified using affinity chromatography techniques. The resulting protein preparations are suitable for various applications including ELISA and Western Blot analyses .

What are the key genetic and structural characteristics of OR2A12?

OR2A12 is characterized by its membership in the G protein-coupled receptor 1 family and its association with specific Gene Ontology (GO) terms including G protein-coupled receptor signaling pathway (GO:0007186), detection of chemical stimulus involved in sensory perception of smell (GO:0050911), plasma membrane localization (GO:0005886), G protein-coupled receptor activity (GO:0004930), and olfactory receptor activity (GO:0004984) . Structurally, it features the characteristic seven-transmembrane domain architecture typical of GPCRs, with specific binding sites for odorant molecules. The receptor's structure-function relationship is crucial for understanding its ligand binding properties and signaling mechanisms.

What methodologies are most effective for determining OR2A12-odorant binding specificity?

Determining OR2A12-odorant binding specificity requires sophisticated experimental approaches. Based on established methodologies for olfactory receptors, the most effective technique involves luciferase-based reporter assays in specialized cell lines such as Hana3A cells, which express necessary chaperon proteins (RTP1, RTP2), olfactory G-proteins, and rho tag . When designing such experiments, researchers should:

  • Test a diverse panel of odorants at multiple concentrations (ranging from nanomolar to millimolar)

  • Include both stereoisomers when testing chiral molecules, as stereochemistry significantly affects binding

  • Control for assay-dependent bias by validating results across different cellular systems

  • Measure dose-response relationships to determine EC50 values

The experimental data should be analyzed to identify both agonists and non-responsive pairs, as both provide valuable information about the receptor's binding pocket characteristics.

How do concentration-dependent effects influence OR2A12 activation patterns?

The activation of OR2A12, like other olfactory receptors, demonstrates significant concentration dependence. At low concentrations, a molecule may not elicit any cellular response, whereas at higher concentrations, it might function as an agonist for OR2A12 and potentially other olfactory receptors . This phenomenon has important implications for experimental design and data interpretation.

Research investigating OR2A12 activation should employ a systematic approach to concentration testing, as shown in the following experimental design table:

OdorantConcentration RangeNumber of ReplicatesAssay MethodData Analysis
Compound A10⁻⁹ - 10⁻³ M5Luciferase reporterNonlinear regression
Compound B10⁻⁹ - 10⁻³ M5Calcium imagingAUC analysis
Compound C10⁻⁹ - 10⁻³ M5cAMP accumulationEC50 determination

When interpreting results, researchers should account for the possibility that receptor selectivity may be dramatically altered at different concentrations, potentially leading to recruitment of different downstream signaling pathways .

What impact do different heterologous expression systems have on OR2A12 functionality studies?

The choice of heterologous expression system significantly influences the outcomes of OR2A12 functionality studies. Research with other olfactory receptors has demonstrated clear assay-dependent bias in ligand identification . For example, potential ligands successfully identified in one cell line (such as human prostate carcinoma LNCaP cells) may not be recognized when the same receptor is expressed in HEK293 cells .

To address this challenge, a comprehensive experimental approach should include:

  • Testing OR2A12 expression and function across multiple cell lines (HEK293, Hana3A, LNCaP)

  • Comparing different assay methodologies (luciferase reporter, calcium imaging, cAMP accumulation)

  • Validating key findings in native olfactory sensory neurons when possible

  • Standardizing experimental conditions across systems to minimize variability

This multi-system validation approach increases confidence in identified agonists and provides deeper insights into the receptor's pharmacology under different cellular contexts.

How can computational approaches complement experimental methods in OR2A12 research?

Computational approaches provide powerful complementary tools for experimental OR2A12 research. Based on methodologies applied to other olfactory receptors, researchers can develop:

  • Homology models of OR2A12 structure based on related GPCRs with resolved crystal structures

  • Virtual screening protocols to identify potential ligands from chemical libraries

  • Molecular dynamics simulations to understand ligand-receptor interactions

  • Machine learning models trained on experimental data to predict novel agonists

When implementing these computational approaches, researchers should utilize comprehensive databases like M2OR that contain curated OR-molecule interaction data (75,050 bioassay experiments for 51,395 distinct OR-molecule pairs) . These resources provide valuable training datasets for machine learning models and validation references for virtual screening results.

What are the optimal conditions for expressing and purifying recombinant OR2A12?

Expressing and purifying functional OR2A12 requires specialized approaches due to the challenges associated with membrane protein production. Based on protocols for similar olfactory receptors, the following methodological considerations are critical:

  • Expression System Selection: Wheat germ cell-free expression systems have proven effective for producing functional olfactory receptor fragments . Alternatively, insect cell systems (Sf9, High Five) may be suitable for full-length receptor expression.

  • Construct Design: Incorporating purification tags (His6, FLAG) at the N- or C-terminus, adding stabilizing mutations, and including fusion partners (T4 lysozyme, BRIL) can enhance expression and stability.

  • Detergent Selection: Mild detergents like DDM, LMNG, or GDN are recommended for extraction and purification to maintain receptor functionality.

  • Quality Control: Employ size exclusion chromatography, circular dichroism, and ligand binding assays to verify proper folding and functionality of the purified receptor.

The purified receptor should be stored in detergent micelles or reconstituted into nanodiscs or liposomes for downstream applications requiring a membrane environment.

How should researchers design bioassays to evaluate OR2A12 responses to potential ligands?

Designing effective bioassays for OR2A12 requires careful consideration of multiple factors. Based on established protocols for olfactory receptors, researchers should consider the following experimental design table:

Assay ParameterRecommendationRationale
Cell LineHana3A (primary), HEK293T (validation)Hana3A cells express chaperon proteins (RTP1, RTP2) that enhance receptor trafficking
Transfection MethodLipofection for transient expressionAllows rapid screening of multiple conditions
Readout SystemDual luciferase reporter (Firefly/Renilla)Provides internal control for normalization
Positive ControlKnown odorant for related receptorValidates assay functionality
Negative ControlVehicle onlyEstablishes baseline response
Concentration Range10⁻⁹ - 10⁻³ M (logarithmic increments)Captures full dose-response relationship
Incubation Time4-6 hours post-stimulationOptimizes signal-to-noise ratio
ReplicatesMinimum 3 biological, 3 technicalEnsures statistical rigor

When analyzing the results, researchers should report both EC50 values and maximum response amplitudes, as these parameters provide complementary information about receptor-ligand interactions .

What are the best practices for analyzing OR2A12 sequence variants and their functional implications?

Analyzing OR2A12 sequence variants requires a systematic approach combining bioinformatics and experimental validation. Researchers should follow these best practices:

  • Sequence Alignment: Compare OR2A12 sequences across populations and species using multiple sequence alignment tools to identify conserved and variable regions.

  • Variant Identification: Utilize genomic databases to catalog known variants (SNPs, indels) and their frequencies in different populations.

  • Structural Mapping: Map variants onto structural models to predict their impact on ligand binding, G-protein coupling, or receptor stability.

  • Functional Testing: Generate receptor variants through site-directed mutagenesis and evaluate their functional properties using standardized bioassays.

  • Data Integration: Correlate variant effects with population data, potentially identifying associations with olfactory phenotypes.

This comprehensive approach enables researchers to understand how genetic diversity influences OR2A12 function and potentially contributes to individual differences in olfactory perception.

How should researchers analyze and interpret concentration-dependent responses of OR2A12?

Analyzing concentration-dependent responses of OR2A12 requires rigorous statistical approaches. Researchers should follow these guidelines:

  • Normalization: Normalize raw data (luminescence, fluorescence, etc.) to appropriate controls to account for day-to-day variability.

  • Curve Fitting: Apply nonlinear regression analysis to fit dose-response curves, preferably using a four-parameter logistic model.

  • Parameter Extraction: Calculate EC50 values (concentration producing 50% of maximum response) and Hill coefficients (slope factors) from fitted curves.

  • Statistical Comparison: Use appropriate statistical tests (ANOVA, t-tests) to compare parameters across different ligands or receptor variants.

  • Visualization: Present data in both tabular and graphical formats, including scatter plots of individual replicates and fitted curves with confidence intervals.

The following table illustrates how concentration-response data might be summarized:

LigandEC50 (μM)95% Confidence IntervalHill CoefficientMaximum Response (% of Reference)
Compound X143112-1821.2100
Compound Y567423-7610.875
Compound Z18901245-28701.535

This rigorous analysis approach enables accurate quantification of ligand potency and efficacy, facilitating comparisons across different compounds.

What criteria should be used to classify compounds as agonists or antagonists of OR2A12?

Establishing clear criteria for classifying compounds as OR2A12 agonists or antagonists is essential for consistent reporting and comparison across studies. Based on approaches used with other olfactory receptors, researchers should apply the following classification framework:

  • Agonist Classification:

    • Concentration-dependent activation exceeding 3 standard deviations above baseline

    • Reproducible response across at least 3 independent experiments

    • Dose-response relationship with calculable EC50

    • Activation confirmed by secondary assay (e.g., calcium imaging if primary was luciferase)

  • Antagonist Classification:

    • Concentration-dependent inhibition of response to known agonist

    • Rightward shift of agonist dose-response curve without reduction in maximal response (competitive)

    • Reduction in maximal response without EC50 shift (non-competitive)

    • Inhibitory effect confirmed in multiple assay systems

  • Inconclusive Results:

    • Inconsistent responses across replicates

    • Non-receptor-mediated effects (e.g., cellular toxicity)

    • Effects only at concentrations exceeding physiological relevance (>1 mM)

This classification framework ensures scientific rigor when categorizing compounds and facilitates the creation of reliable databases of OR2A12 ligands similar to the M2OR database for other olfactory receptors .

How can researchers integrate OR2A12 data with broader olfactory receptor databases?

Integrating OR2A12 research data with broader olfactory receptor databases requires standardized approaches to data collection and reporting. Researchers should follow these guidelines:

  • Data Standardization: Record experimental details in accordance with database requirements, including:

    • Complete stereochemical information for tested compounds

    • Screening concentrations and/or EC50 values

    • Detailed experimental procedures (cell lines, assay types, time points)

    • Both responsive and non-responsive compound pairs

  • Database Submission: Format data for submission to repositories like M2OR (https://m2or.chemsensim.fr/), which contains over 75,050 bioassay experiments for olfactory receptor-molecule interactions .

  • Cross-Referencing: Link OR2A12 data with other databases containing genomic and proteomic information on olfactory receptors.

  • Meta-Analysis Preparation: Include statistical measures of confidence and variability to enable meta-analyses across multiple studies.

By adhering to these practices, researchers contribute to the collective knowledge of olfactory receptor function and enable more powerful analyses across receptor subtypes and chemical spaces.

What are promising approaches for investigating OR2A12 functions beyond the olfactory system?

The expression of OR2A12 in non-olfactory tissues (thymus, ovary, pancreas, breast, prostate) suggests potential functions beyond odor detection. Researchers interested in these non-canonical functions should consider these approaches:

  • Tissue-Specific Signaling Analysis: Investigate OR2A12 coupling to different G-protein subtypes and downstream signaling pathways in non-olfactory tissues.

  • Conditional Knockout Models: Develop tissue-specific OR2A12 knockout models to evaluate physiological functions in different organ systems.

  • Endogenous Ligand Identification: Screen tissue metabolomes to identify potential endogenous ligands that may activate OR2A12 in non-olfactory contexts.

  • Disease Association Studies: Analyze correlations between OR2A12 expression/variants and disease states in tissues with significant receptor expression.

  • Interactome Mapping: Identify protein-protein interactions specific to OR2A12 in different tissue contexts using approaches like proximity labeling or co-immunoprecipitation.

These investigations may reveal novel roles for OR2A12 in processes like immune function (thymus), reproduction (ovary), or metabolism (pancreas), expanding our understanding of olfactory receptor biology beyond sensory perception.

How can high-throughput screening approaches be optimized for OR2A12 ligand discovery?

Optimizing high-throughput screening (HTS) for OR2A12 ligand discovery requires addressing several technical challenges specific to olfactory receptors. Researchers should implement these strategies:

  • Stable Cell Line Development: Generate cell lines with stable, inducible expression of OR2A12 along with accessory proteins (RTP1/2, REEP1) to improve screening consistency.

  • Miniaturization: Adapt assays to 384- or 1536-well format while maintaining signal quality and reproducibility.

  • Multiplexed Readouts: Implement multiplexed assay systems measuring multiple parameters (e.g., calcium flux and cAMP) to capture different signaling modes.

  • Chemical Library Design: Curate chemical libraries with diverse scaffolds, including stereoisomers, to maximize chemical space exploration .

  • Machine Learning Integration: Apply machine learning algorithms to predict active compounds based on initial screening results, guiding subsequent screening rounds.

This optimized approach increases the likelihood of identifying novel OR2A12 ligands while reducing false positives and negatives commonly encountered in GPCR screening campaigns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.