Recombinant Human Olfactory receptor 2A14 (OR2A14)

Shipped with Ice Packs
In Stock

Description

Functional and Mechanistic Insights

OR2A14 detects volatile odorants, initiating a cAMP-mediated signaling cascade via Gα<sub>olf</sub> protein activation. While its specific ligands remain uncharacterized, studies suggest it participates in combinatorial odor coding . Key findings include:

  • Copy-number variation: Polymorphisms in the OR2A14 locus contribute to interindividual differences in olfactory perception .

  • Low endogenous expression: Detected at ≤35 PCR cycles in human olfactory mucosa, necessitating recombinant overexpression for functional studies .

  • Tdark classification: Indicates understudied therapeutic potential and limited ligand data .

Antibody Development

Polyclonal antibodies (e.g., PACO03475) target the C-terminal region (synthesized peptide: residues 300–310) for applications in Western blot, immunofluorescence, and flow cytometry .

Odorant Screening

Recombinant OR2A14 is used in luciferase-based assays (e.g., Hana3A cells) to identify agonists/antagonists. The M2OR database catalogs 75,050 odorant-receptor interaction experiments, though OR2A14-specific data remain sparse .

Challenges in OR2A14 Research

ChallengeDetail
Low native expressionRequires heterologous systems (e.g., HEK293) for adequate yield
Pseudogenization risks24% of human ORs are pseudogenes; OR2A14’s functional status is confirmed
Assay variabilityCell-line-specific biases affect ligand responses (e.g., LNCaP vs. HEK293)

Future Directions

Recombinant OR2A14 enables deorphanization efforts to identify ligands and explore roles beyond olfaction (e.g., ectopic expression in prostate cancer) . Structural characterization and high-throughput screening remain priorities to elucidate its role in sensory biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2A14; OR2A14P; OR2A6; Olfactory receptor 2A14; OST182; Olfactory receptor 2A6; Olfactory receptor OR7-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2A14
Target Protein Sequence
MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL RRALRKERLT
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15084

KEGG: hsa:135941

STRING: 9606.ENSP00000386137

UniGene: Hs.534547

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2A14 and what is its role in olfactory function?

OR2A14 is an olfactory receptor belonging to the G-protein coupled receptor 1 family that plays a crucial role in the detection of chemical stimuli involved in sensory perception of smell. Similar to other olfactory receptors, OR2A14 is involved in the initial stages of the olfactory signaling pathway, binding to specific odorant molecules and initiating signal transduction through G protein-coupled receptor signaling pathways . This receptor is part of the largest gene family in the human genome, with approximately 400 intact human odorant receptors capable of discriminating a vast number of odors . The receptor contains specific binding domains that interact with odorant molecules, triggering conformational changes that activate downstream signaling cascades essential for smell perception .

How is recombinant OR2A14 protein typically expressed and purified for research?

Recombinant OR2A14 protein is typically expressed using heterologous expression systems similar to other olfactory receptors. Based on established protocols for similar olfactory receptors, the protein can be expressed in wheat germ cell-free systems, which has proven effective for other difficult-to-express membrane proteins like OR2A2 . The expression process typically involves cloning the OR2A14 coding sequence into an appropriate vector, followed by in vitro transcription and translation in the wheat germ extract.

For purification, researchers typically employ affinity chromatography techniques using epitope tags (such as His-tag or FLAG-tag) fused to the recombinant protein. The purified protein can then be validated using techniques such as SDS-PAGE with Coomassie Blue staining to verify purity and integrity, similar to the quality control methods used for OR2A2 . Researchers should note that as a membrane protein, special considerations regarding detergents and buffer conditions are necessary to maintain proper protein folding and function during the purification process.

What analytical methods are used to verify the structure and function of recombinant OR2A14?

Several analytical methods can be employed to verify both the structure and function of recombinant OR2A14:

Structural verification methods:

  • SDS-PAGE analysis with Coomassie Blue staining to confirm protein size and purity

  • Western blotting using specific antibodies against OR2A14 or epitope tags

  • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Limited proteolysis combined with mass spectrometry to evaluate protein folding

Functional verification methods:

  • Heterologous luciferase assays to measure receptor activation in response to odorants

  • Calcium imaging to detect intracellular calcium flux upon receptor activation

  • GTPγS binding assays to measure G-protein coupling efficiency

  • Surface plasmon resonance (SPR) to quantify ligand binding kinetics

When conducting functional assays, researchers typically test multiple concentrations (e.g., 1, 10, and 100 μM) of potential ligands to establish dose-response relationships, as described in protocols for testing other olfactory receptors . Controls should include no-odor conditions and positive controls using receptors with known ligands.

How should I design an experiment to identify potential ligands for OR2A14?

Designing an experiment to identify potential ligands for OR2A14 requires a systematic approach:

  • Establish a heterologous expression system: Use cell lines (typically HEK293T) that do not endogenously express olfactory receptors. Transfect cells with the OR2A14 expression vector alongside necessary accessory proteins (such as RTP1S, RTP2, REEP1, or Gαolf) that facilitate receptor trafficking and signaling .

  • Select an appropriate assay system: The luciferase reporter assay system is widely used for olfactory receptor screening. Design a construct where luciferase expression is driven by a promoter responsive to cAMP signaling (activated downstream of olfactory receptor stimulation) .

  • Create an odorant library: Select diverse odorants spanning different chemical classes, functional groups, and structural properties. Consider including structurally related compounds to any known ligands of phylogenetically similar receptors.

  • Implement a multi-tiered screening approach:

    • Primary screen: Test odorants at a single concentration (typically 100 μM) to identify potential hits

    • Secondary screen: Test positive hits at multiple concentrations (1, 10, and 100 μM) to establish dose-response relationships

    • Validation: Perform triplicate measurements for each odorant-receptor pair

  • Include proper controls:

    • Negative controls: No-odor conditions to establish baseline activity

    • Positive controls: Well-characterized receptor-ligand pairs (e.g., Olfr544 and nonanedioic acid)

    • Mock-transfected cells to control for non-specific effects

  • Data analysis: Normalize responses, calculate z-scores, and rank hits based on statistical significance following methods similar to those used in other olfactory receptor studies .

This systematic approach facilitates the identification of specific ligands while minimizing false positives through rigorous controls and validation steps.

What are the key considerations when optimizing expression systems for OR2A14?

Optimizing expression systems for OR2A14 requires addressing several key challenges inherent to olfactory receptors:

  • Selection of appropriate expression system:

    • Mammalian cell lines (HEK293T, HeLa) provide proper post-translational modifications

    • Wheat germ cell-free systems offer advantages for difficult-to-express membrane proteins

    • Insect cell systems (Sf9, Hi5) may provide higher yields with proper folding

  • Codon optimization: Adjust the OR2A14 coding sequence to reflect codon bias of the host system to enhance translation efficiency.

  • Expression vector design:

    • Include strong, inducible promoters (CMV for mammalian cells)

    • Add trafficking enhancer sequences (e.g., Lucy tag, rhodopsin tag)

    • Engineer epitope tags (His, FLAG) for detection and purification

    • Consider fusion partners (MBP, SUMO) to improve solubility

  • Co-expression of accessory proteins:

    • RTP1S, RTP2: Enhance receptor trafficking to the cell membrane

    • REEP1: Improves receptor expression

    • Gαolf: Facilitates coupling to downstream signaling pathways

  • Optimization of expression conditions:

    • Temperature: Lower temperatures (30°C instead of 37°C) may improve folding

    • Culture media composition: Supplements like sodium butyrate can enhance expression

    • Induction timing and duration for inducible systems

  • Detergent selection for membrane protein extraction:

    • Mild detergents (DDM, CHAPS) preserve protein structure and function

    • Detergent screening is essential to determine optimal extraction conditions

  • Quality control metrics:

    • Protein yield quantification

    • Functional assays to confirm proper folding and activity

    • Homogeneity assessment via size exclusion chromatography

Careful optimization of these parameters is essential for obtaining functional recombinant OR2A14 protein suitable for downstream applications such as ligand screening and structural studies.

How can I validate OR2A14 activity in a heterologous expression system?

Validating OR2A14 activity in heterologous expression systems requires a multi-faceted approach:

  • Expression verification:

    • Western blotting to confirm protein expression using anti-OR2A14 antibodies or epitope tag antibodies

    • Immunofluorescence microscopy to verify proper membrane localization

    • Flow cytometry to quantify surface expression levels

  • Functional assays:

    • Luciferase reporter assays: Design a construct where luciferase expression is driven by cAMP-responsive elements (CRE). Upon receptor activation, increased cAMP levels activate CRE, leading to luciferase expression that can be quantified .

    • Calcium imaging: Load cells with calcium-sensitive dyes (Fluo-4, Fura-2) to detect intracellular calcium flux upon receptor activation.

    • BRET/FRET assays: Measure protein-protein interactions between the receptor and G proteins using bioluminescence/fluorescence resonance energy transfer.

    • Electrophysiology: Patch-clamp recordings to measure ion channel activity downstream of receptor activation.

  • Dose-response relationships:

    • Test known or suspected ligands at multiple concentrations (e.g., 1, 10, and 100 μM)

    • Calculate EC₅₀ values to determine potency

    • Compare responses to both positive and negative controls

  • Controls and validation:

    • Negative controls: Mock-transfected cells, cells expressing unrelated receptors

    • Positive controls: Cells expressing well-characterized olfactory receptors (e.g., Olfr544)

    • Antagonist testing: If available, confirm specificity using competitive antagonists

    • Structural analogs: Test structurally similar compounds to establish structure-activity relationships

  • Receptor specificity verification:

    • Site-directed mutagenesis of key binding residues should alter response profiles

    • Chimeric receptors can help identify domains responsible for ligand specificity

A representative data table for OR2A14 validation might look like this:

OdorantConcentration (μM)Fold activation (mean ± SEM)p-valueEC₅₀ (μM)
Ligand A11.3 ± 0.20.0845.2
Ligand A102.5 ± 0.30.01-
Ligand A1004.8 ± 0.40.001-
Ligand B10.9 ± 0.10.42>100
Ligand B101.1 ± 0.20.31-
Ligand B1001.8 ± 0.30.04-
No odor-1.0 ± 0.1--

This comprehensive validation approach ensures that the observed activity genuinely reflects OR2A14 function rather than artifacts of the expression system.

What approaches can be used to study OR2A14 structure-function relationships?

Studying structure-function relationships of OR2A14 requires sophisticated approaches that combine computational, molecular, and functional techniques:

  • Homology modeling and computational analysis:

    • Generate 3D models based on crystal structures of related GPCRs

    • Identify putative binding pocket residues through sequence alignment with characterized olfactory receptors

    • Perform molecular docking simulations with potential ligands to predict binding modes

    • Use molecular dynamics simulations to study receptor conformational changes

  • Site-directed mutagenesis:

    • Systematically mutate residues in predicted binding pockets

    • Focus on highly conserved residues across the olfactory receptor family

    • Create alanine-scanning libraries of transmembrane domains

    • Develop chimeric receptors by swapping domains with related olfactory receptors

  • Functional characterization of mutants:

    • Assess the effect of mutations on receptor trafficking and membrane localization

    • Measure changes in ligand binding affinity and specificity

    • Evaluate alterations in signaling efficacy and G-protein coupling

    • Construct dose-response curves to quantify functional impacts

  • Advanced biophysical techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

    • Nuclear magnetic resonance (NMR) spectroscopy for structural analysis of receptor fragments

    • Cryo-electron microscopy for structural determination of the intact receptor

    • Single-molecule FRET to study conformational changes upon ligand binding

  • Cross-linking studies:

    • Photo-affinity labeling to identify specific binding sites

    • Chemical cross-linking combined with mass spectrometry to map protein-protein interactions

    • Disulfide trapping to determine proximity relationships between receptor elements

A typical data table from a structure-function study might look like:

MutationSurface Expression (% of WT)EC₅₀ for Ligand A (μM)Emax (% of WT)Ligand Specificity Change
Wild-type100 ± 545.2 ± 3.1100 ± 4Reference
Y104A92 ± 8126.7 ± 12.385 ± 7Reduced affinity for aromatic odorants
D112N103 ± 6>20032 ± 5Loss of response to acidic odorants
F203A25 ± 7NDNDTrafficking defect
TM3-OR2A2 chimera88 ± 951.3 ± 4.293 ± 6Gained affinity for aldehydes

These integrated approaches provide comprehensive insights into the molecular determinants of OR2A14 ligand recognition and activation mechanisms.

How can high-throughput screening be optimized for OR2A14 ligand discovery?

Optimizing high-throughput screening (HTS) for OR2A14 ligand discovery requires careful consideration of multiple factors to maximize efficiency, sensitivity, and specificity:

  • Assay development and miniaturization:

    • Adapt luciferase reporter systems to 384- or 1536-well plate formats

    • Optimize cell density, transfection efficiency, and assay volumes

    • Develop homogeneous ("mix and read") assays to minimize handling steps

    • Implement automated liquid handling systems for reproducibility

  • Screening library design:

    • Curate diverse odorant libraries spanning multiple chemical classes

    • Include known ligands of phylogenetically related olfactory receptors

    • Utilize computational approaches to select compounds based on pharmacophore models

    • Consider fragment-based approaches for novel chemotype discovery

  • Quality control and assay validation:

    • Calculate Z' factor to ensure assay robustness (aim for Z' > 0.5)

    • Determine signal-to-background ratio and coefficient of variation

    • Implement plate uniformity assessments to detect positional effects

    • Include internal controls on each plate for normalization

  • Multi-stage screening strategy:

    • Primary screen: Single concentration (typically 10-100 μM) to identify hits

    • Secondary screen: Dose-response relationships for hit confirmation

    • Counter-screening against related receptors to determine selectivity

    • Orthogonal assays to confirm activity through different readout methods

  • Data analysis and hit prioritization:

    • Implement standardized plate normalization procedures

    • Calculate z-scores to rank compounds based on statistical significance

    • Apply percentile ranking methods to identify robust hits

    • Use machine learning algorithms to identify structure-activity relationships

  • Automation and throughput optimization:

    • Integrate robotic platforms for cell seeding, transfection, and compound addition

    • Implement automated imaging systems for cellular localization studies

    • Develop barcode tracking systems for sample management

    • Implement data management systems for automated analysis pipelines

A typical high-throughput screening results table might look like:

Screening PhaseCompounds TestedActive Hits (% hit rate)Confirmation RateNovel Chemotypes Identified
Primary Screen10,000320 (3.2%)--
Dose-Response320145 (45.3%)--
Selectivity14568 (46.9%)21.2% of primary hits12
Orthogonal Assays6841 (60.3%)12.8% of primary hits8

This systematic approach to HTS optimization balances throughput, sensitivity, and specificity to efficiently identify genuine OR2A14 ligands while minimizing false positives and resource utilization.

What methods are available for studying OR2A14 signaling pathways and their regulation?

Studying OR2A14 signaling pathways and their regulation requires a comprehensive toolbox of molecular, cellular, and systems-level approaches:

  • G-protein coupling and immediate signaling events:

    • BRET/FRET assays: Directly measure receptor-G protein interactions and conformational changes

    • GTPγS binding assays: Quantify G-protein activation following receptor stimulation

    • G-protein subtype specificity: Use pertussis toxin (Gαi/o inhibitor) or cholera toxin (Gαs activator) to determine G-protein subtypes involved

    • Second messenger assays: Measure cAMP (using ELISA or FRET-based sensors) or calcium flux (using fluorescent indicators)

  • Downstream signaling pathway analysis:

    • Phosphoprotein profiling: Use phospho-specific antibodies or mass spectrometry to identify activated signaling proteins

    • Kinase activity assays: Determine activation of PKA, PKC, MAPKs, and other downstream kinases

    • Transcriptional reporter assays: Measure activation of CREB, NFAT, or other transcription factors

    • RNA-seq after receptor activation: Identify gene expression changes triggered by receptor signaling

  • Receptor regulation mechanisms:

    • Desensitization studies: Measure receptor responses after repeated or prolonged stimulation

    • Internalization assays: Quantify receptor trafficking using surface biotinylation or fluorescence-based approaches

    • Phosphorylation site mapping: Identify regulatory phosphorylation sites using mass spectrometry

    • GRK and arrestin recruitment: Measure kinetics of regulatory protein recruitment using BRET/FRET

  • Signaling complex formation:

    • Co-immunoprecipitation: Identify protein-protein interactions in signaling complexes

    • Proximity labeling: Use BioID or APEX2 to identify proteins in close proximity to the activated receptor

    • Super-resolution microscopy: Visualize signaling complexes at nanoscale resolution

    • Native mass spectrometry: Analyze intact protein complexes formed during signaling

  • Pathway perturbation approaches:

    • Pharmacological inhibitors: Use specific inhibitors targeting different pathway components

    • CRISPR/Cas9 gene editing: Generate knockout or knockin cell lines for pathway components

    • siRNA/shRNA: Transiently deplete specific signaling proteins

    • Dominant-negative mutants: Express modified proteins that interfere with specific signaling steps

A representative data table from OR2A14 signaling pathway analysis might include:

Signaling Pathway ComponentActivation State After Ligand StimulationEffect of Inhibition on OR2A14 ResponseTemporal Dynamics
Gαolf↑ 8.3-foldAbolishes responseRapid (< 30 sec)
cAMP↑ 5.2-fold-Peak at 2-3 min
PKA↑ 3.1-fold78% reductionSustained (> 15 min)
p-CREB↑ 2.7-fold65% reductionDelayed (5-10 min)
p-ERK1/2↑ 4.6-fold43% reductionBiphasic (2 and 15 min)
GRK3 recruitmentDetectedEnhanced desensitizationRapid (< 1 min)
β-arrestin2 recruitmentDetectedBlocked internalizationDelayed (3-5 min)

These comprehensive approaches provide detailed insights into the complex signaling networks initiated by OR2A14 activation and the regulatory mechanisms that control receptor function.

How does OR2A14 compare functionally with other olfactory receptors in its family?

Comparing OR2A14 functionally with other olfactory receptors requires systematic analysis across multiple dimensions:

  • Sequence and structural comparisons:

    • Phylogenetic analysis to establish evolutionary relationships within the OR2A subfamily

    • Sequence alignments to identify conserved and divergent regions

    • Homology modeling to compare predicted binding pocket architecture

    • Conservation analysis of key functional motifs (e.g., DRY motif, toggle switch residues)

  • Ligand specificity profiling:

    • Systematic testing of odorant panels across multiple receptors

    • Construction of shared chemical space maps for related receptors

    • Determination of receptor-specific and overlapping ligands

    • Comparison of structure-activity relationships across the receptor family

  • Signaling characteristics:

    • G-protein coupling preferences and efficacy

    • Signaling kinetics and desensitization rates

    • Second messenger production profiles

    • Bias toward different downstream pathways

  • Expression pattern analysis:

    • Tissue distribution comparisons using RNA-seq data

    • Single-cell transcriptomics to identify co-expression patterns

    • Developmental regulation of expression

    • Species conservation of expression patterns

  • Functional genomics approaches:

    • CRISPR/Cas9 knockout/knockin studies to assess functional redundancy

    • Cross-receptor complementation experiments

    • Chimeric receptor studies to map functional domains

Comparative data for OR2A subfamily members might be presented as:

PropertyOR2A14OR2A2OR2A7OR2A5
Sequence identity to OR2A14100%87%82%76%
Top ligand classAldehydesEstersKetonesTerpenes
EC₅₀ for shared ligand (citronellal)38 μM12 μM>100 μM67 μM
G-protein preferenceGαolf >> GαsGαolf > GαsGαolf ≈ GαsGαs > Gαolf
Desensitization half-time8.2 min4.5 min12.7 min7.9 min
Primary expression locationUpper septumDorsal zoneLateral zoneWidespread
Conservation (human/mouse ortholog)92% identity89% identityPseudogene in mouse87% identity

Additionally, comparative analysis might include ligand recognition fingerprints across multiple receptors in the subfamily:

OdorantOR2A14 responseOR2A2 responseOR2A7 responseOR2A5 response
Citronellal++++++++++++++
Benzaldehyde+++++++++-
Octanal++++++++++
Hexyl acetate++++++++
Menthone-+++++++++
Limonene---++++

These comparative analyses provide insights into the functional specialization and redundancy within the OR2A subfamily, contributing to our understanding of the combinatorial coding of olfactory information.

How can OR2A14 research be applied to study olfactory dysfunction in disease models?

OR2A14 research can be strategically applied to investigate olfactory dysfunction in various disease models through several approaches:

  • Neurodegenerative diseases (Alzheimer's, Parkinson's):

    • Analyze OR2A14 expression changes in patient olfactory epithelium samples

    • Develop transgenic mouse models expressing reporter-tagged OR2A14 to visualize changes in receptor localization and axonal projections

    • Study the impact of disease-associated protein aggregates (Aβ, α-synuclein) on OR2A14 trafficking and function

    • Examine olfactory bulb connectivity changes specific to OR2A14-expressing neurons

  • COVID-19 and post-viral olfactory dysfunction:

    • Investigate SARS-CoV-2 effects on OR2A14-expressing cells using organoid models

    • Analyze receptor internalization and trafficking disruption following viral infection

    • Study inflammatory cytokine effects on OR2A14 signaling pathways

    • Track recovery patterns of OR2A14 expression during post-infection regeneration

  • Metabolic disorders (diabetes, obesity):

    • Examine glucose regulation of OR2A14 expression and function

    • Investigate receptor sensitivity changes in hyperglycemic conditions

    • Study leptin and insulin effects on OR2A14 signaling

    • Develop diet-induced obesity models to track progressive changes in OR2A14 function

  • Psychiatric disorders:

    • Analyze OR2A14 genetic variants in conditions with olfactory phenotypes (schizophrenia, depression)

    • Study the impact of neurotransmitter imbalances on OR2A14 signaling

    • Examine effects of psychotropic medications on receptor function

    • Develop behavioral assays specifically targeting OR2A14-mediated olfactory perception

  • Methodological approaches:

    • Generate patient-derived iPSCs differentiated into olfactory sensory neurons

    • Develop physiologically relevant 3D culture systems (air-liquid interface cultures)

    • Use CRISPR/Cas9 to introduce disease-associated mutations

    • Apply single-cell transcriptomics to track cell-type specific changes

A representative data table from studies of OR2A14 in disease models might include:

Disease ModelOR2A14 ExpressionFunctional Response to LigandsTrafficking to CiliaAssociated Pathological Changes
Alzheimer's (APP/PS1 mice)↓ 62%↓ 83%ImpairedAβ deposits in olfactory epithelium
Parkinson's (α-syn A53T)↓ 47%↓ 52%Partially impairedLewy body-like inclusions
COVID-19 (hACE2 mice)↓ 78%↓ 91%Severely impairedSustentacular cell damage
Type 2 diabetes (db/db mice)↑ 23%↓ 38%NormalBasal cell hyperplasia
Depression (UCMS model)↓ 31%↓ 44%NormalReduced olfactory bulb volume

These approaches enable the mechanistic investigation of olfactory dysfunction across various disease contexts, potentially revealing both disease-specific and common pathophysiological mechanisms affecting OR2A14 function.

What are the technical challenges in developing selective ligands for OR2A14?

Developing selective ligands for OR2A14 presents several technical challenges that researchers must address:

  • Binding pocket characterization challenges:

    • Limited structural information due to difficulties in crystallizing membrane proteins

    • High sequence similarity among olfactory receptor subtypes complicating selectivity

    • Multiple binding modes possible within a single receptor

    • Conformational flexibility of the binding pocket

  • Chemical space exploration limitations:

    • Vast odorant chemical space making exhaustive screening impractical

    • Lack of clear structure-activity relationships for olfactory receptors

    • Difficulty in predicting odorant-receptor interactions from primary sequence

    • Limited commercial availability of diverse odorant libraries

  • Selectivity screening hurdles:

    • Need for parallel screening against multiple related receptors

    • Overlapping ligand recognition profiles among olfactory receptors

    • Potential for allosteric interactions affecting binding profiles

    • Concentration-dependent selectivity profiles

  • Physicochemical property constraints:

    • Volatile nature of most odorants limiting structural diversity

    • Lipophilicity requirements for accessing binding sites

    • Solubility challenges in aqueous assay systems

    • Stability issues with reactive functional groups

  • Methodological approaches to address challenges:

    • Fragment-based screening: Test molecular fragments to build selective ligands

    • Structure-guided design: Use homology models and docking simulations

    • Diversity-oriented synthesis: Generate focused libraries around promising scaffolds

    • Bioisosteric replacement: Modify structures to improve selectivity while maintaining activity

  • Analytical challenges:

    • Developing reliable high-throughput assays with sufficient sensitivity

    • Accounting for non-specific effects in cell-based systems

    • Differentiating between orthosteric and allosteric effects

    • Verifying direct binding versus downstream signaling effects

A comparative table of approaches for developing selective OR2A14 ligands might include:

ApproachAdvantagesLimitationsSuccess Metrics
High-throughput screeningUnbiased, can identify novel chemotypesResource-intensive, high false positive rateHit rate, confirmation rate, selectivity ratio
Computational structure-based designCost-effective, can focus on selectivity determinantsRelies on homology models, may miss novel binding modesBinding energy predictions, hit rate from virtual screening
Medicinal chemistry optimizationSystematic optimization of potency and selectivityTime-consuming, requires starting scaffoldsImprovement in EC₅₀, selectivity index over iterations
Fragment-based approachEfficient exploration of chemical spaceChallenges in assay sensitivity for fragmentsFragment hit rates, successful fragment growing/linking
Peptidomimetic approachCan target specific receptor regionsLimited by peptide delivery challengesBinding affinity, selectivity against related receptors

Addressing these technical challenges requires an integrated approach combining computational methods, medicinal chemistry expertise, and robust biological assays to systematically develop selective ligands for OR2A14.

What bioinformatic resources and tools are available for OR2A14 research?

Researchers studying OR2A14 can leverage a variety of bioinformatic resources and tools across different aspects of their work:

  • Sequence and structural analysis tools:

    • UniProt/Swiss-Prot: Curated protein sequence and functional annotation

    • NCBI Gene/Protein databases: Comprehensive genetic and protein information

    • GPCRDB: Specialized database for G-protein coupled receptors with annotated motifs

    • I-TASSER/SWISS-MODEL: Protein structure prediction and homology modeling

    • PyMOL/Chimera: Visualization and analysis of protein structures

    • ConSurf: Conservation analysis across receptor families

  • Genomic resources:

    • Ensembl/UCSC Genome Browser: Genomic context and conservation

    • GTEx Portal: Tissue expression patterns across human tissues

    • dbSNP/gnomAD: Genetic variation and population frequencies

    • RegulomeDB: Regulatory elements associated with the gene

    • HaploReg: Linkage disequilibrium and regulatory motif analysis

  • Transcriptomic and expression databases:

    • Gene Expression Omnibus (GEO): Repository of expression datasets

    • Human Protein Atlas: Protein expression across tissues

    • Single Cell Portal: Single-cell RNA-seq datasets

    • Allen Brain Atlas: Brain expression patterns

    • BioGPS: Gene expression across diverse datasets

  • Olfactory-specific resources:

    • ODORactor database: Odorant-receptor interactions

    • OlfactionDB: Olfactory receptor sequences and ligands

    • SenseLab/ORDB: Olfactory receptor database

    • DrugBank: Chemical information for odorant molecules

    • PubChem/ChEMBL: Comprehensive chemical databases

  • Pathway and interaction analysis:

    • STRING/IntAct: Protein-protein interaction networks

    • KEGG/Reactome: Pathway databases

    • Ingenuity Pathway Analysis: Curated pathway analysis tool

    • Cytoscape: Network visualization and analysis

    • Gene Ontology Resource: Functional annotation

  • Specialized analysis tools:

    • BLAST/HMMER: Sequence similarity searching

    • Clustal Omega/MUSCLE: Multiple sequence alignment

    • MEGA/MrBayes: Phylogenetic analysis

    • DAVID/PANTHER: Functional enrichment analysis

    • AutoDock/HADDOCK: Molecular docking tools

A resource utilization table for different aspects of OR2A14 research might include:

Research QuestionPrimary ResourcesComplementary ToolsOutput Formats
Evolutionary conservationNCBI Protein, MEGA, Clustal OmegaConSurf, PAMLPhylogenetic trees, conservation scores
Expression patternsGTEx, Single Cell Portal, BioGPSR/Bioconductor packages, SeuratExpression heatmaps, tissue profiles
Structural analysisSWISS-MODEL, PyMOL, GPCRDBModeller, AutoDockPDB files, binding site predictions
Ligand predictionsChEMBL, PubChem, ODORactorRDKit, AutoDock VinaStructure-activity maps, binding affinity predictions
Variant analysisgnomAD, dbSNP, Ensembl VEPSIFT, PolyPhen, CADDVariant pathogenicity scores, population frequencies

These bioinformatic resources provide comprehensive support for diverse aspects of OR2A14 research, enabling integrated analyses from sequence to function and from individual receptors to system-level understanding.

What are the current knowledge gaps in OR2A14 research?

Despite advances in olfactory receptor research, significant knowledge gaps remain in our understanding of OR2A14:

  • Structural characterization: The three-dimensional structure of OR2A14 remains unresolved, limiting our understanding of ligand binding mechanisms and receptor activation. Unlike some GPCRs, olfactory receptors have proven particularly challenging for crystallography or cryo-EM studies due to their inherent flexibility and expression challenges.

  • Physiological ligands: The endogenous ligands that activate OR2A14 under natural conditions remain largely unidentified. While screening approaches have identified potential activators for some olfactory receptors, comprehensive deorphanization efforts for OR2A14 are still needed .

  • Signaling specificity: The precise G-protein coupling preferences and downstream signaling pathways activated by OR2A14 compared to other olfactory receptors remain poorly characterized. Understanding these signaling networks is essential for deciphering the receptor's contribution to olfactory coding.

  • Genetic variation effects: The functional consequences of genetic polymorphisms in OR2A14 across human populations and their potential contribution to individual differences in olfactory perception require systematic investigation.

  • Extra-nasal functions: Potential roles of OR2A14 in tissues outside the olfactory epithelium remain largely unexplored, despite growing evidence for ectopic expression of olfactory receptors in various tissues and their involvement in physiological processes beyond olfaction.

  • Regulatory mechanisms: The transcriptional and post-translational regulation of OR2A14 expression during development and in response to environmental factors remains poorly understood, including the mechanisms governing the one-receptor-per-neuron rule.

  • Comparative biology: Cross-species differences in OR2A14 function and ligand specificity have not been systematically characterized, limiting our understanding of evolutionary adaptations in olfactory perception.

Addressing these knowledge gaps requires interdisciplinary approaches combining molecular biology, structural biology, genetics, neuroscience, and computational methods to advance our understanding of OR2A14 biology and its contribution to olfactory function.

What future directions are most promising for OR2A14 research?

Several promising future directions for OR2A14 research have the potential to significantly advance our understanding of this receptor and its applications:

  • Single-cell multi-omics approaches:

    • Integrating single-cell transcriptomics, proteomics, and spatial mapping

    • Characterizing the complete molecular signature of OR2A14-expressing neurons

    • Mapping the developmental trajectory and regulatory networks

    • This approach could reveal previously unrecognized heterogeneity among OR2A14-expressing cells and their integration into olfactory circuits.

  • Advanced structural biology techniques:

    • Application of cryo-EM for membrane protein structural determination

    • Incorporation of lipid nanodiscs to maintain native-like environments

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • These methods could finally reveal the three-dimensional structure of OR2A14, providing crucial insights into ligand recognition mechanisms.

  • Synthetic biology and receptor engineering:

    • Development of chimeric OR2A14 variants with altered specificity

    • Creation of biosensors based on OR2A14 for environmental monitoring

    • Engineered signaling outputs for synthetic biology applications

    • Such approaches could yield novel tools for detecting specific chemicals and expand the application of olfactory receptors beyond basic research.

  • In vivo functional characterization:

    • CRISPR/Cas9 modification of endogenous OR2A14 loci

    • In vivo calcium imaging of OR2A14-expressing neurons

    • Optogenetic manipulation of specific olfactory neuron populations

    • These techniques would provide unprecedented insights into the role of OR2A14 in natural olfactory behaviors and perception.

  • Translational and clinical applications:

    • Development of OR2A14-targeted therapies for olfactory dysfunction

    • Screening for modulators to enhance or inhibit specific olfactory pathways

    • Creation of patient-derived models to study personalized olfactory function

    • This direction could lead to novel therapeutic strategies for olfactory disorders associated with aging, neurodegenerative diseases, or post-viral syndromes.

  • Computational and AI-driven approaches:

    • Machine learning models to predict OR2A14 ligands from chemical structures

    • Network-based analyses of olfactory receptor interactions

    • Molecular dynamics simulations of receptor-ligand complexes

    • These computational methods could accelerate ligand discovery and provide mechanistic insights into receptor function that complement experimental approaches.

  • Interspecies comparative analysis:

    • Systematic characterization of OR2A14 orthologs across species

    • Investigation of evolutionary adaptations in receptor function

    • Analysis of ecological relevance for species-specific variations

    • This evolutionary perspective could reveal fundamental principles of olfactory receptor adaptation and specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.