Recombinant Human Olfactory receptor 2A25 (OR2A25)

Shipped with Ice Packs
In Stock

Description

Functional Role in Olfaction

OR2A25 facilitates odorant detection through GPCR-mediated signaling:

  • Mechanism: Ligand binding induces conformational changes, activating Gₒₗf proteins. This triggers cAMP production, opening ion channels to depolarize olfactory neurons .

  • Ligand Specificity: Binds structurally diverse odorants, with affinity modulated by metal ions like copper in extracellular domains .

  • Expression: Primarily localized to olfactory epithelium and sperm cells, suggesting roles in chemosensation and chemotaxis .

Production and Purification

Recombinant OR2A25 is synthesized in E. coli systems for experimental use. Key production details include:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C

The protein is reconstituted in sterile water, with glycerol (5–50%) recommended for long-term storage .

Ligand Screening

  • Used in heterologous cell assays to identify activating odorants via calcium imaging or cAMP assays .

  • Structural studies utilize cryo-EM and mutagenesis to map ligand-binding pockets .

Immunochemical Detection

  • Validated antibodies (e.g., Boster Bio A30863) enable Western blot (1:500–1:2000 dilution), immunofluorescence, and ELISA .

  • Detects endogenous OR2A25 in human tissues, including airway epithelium .

Disease Associations

  • Investigated in neurodegenerative disorders (e.g., Alzheimer’s) due to metalloprotein dysfunction hypotheses .

  • Polymorphisms in OR2A25 may influence anosmia or hyperosmia phenotypes .

Challenges and Limitations

  • Pseudogene Interference: OR2A25P, a pseudogene, complicates genomic and transcriptomic analyses .

  • Low Natural Abundance: Endogenous expression is limited to specialized cells, necessitating recombinant overexpression .

  • Structural Dynamics: The receptor’s flexibility complicates crystallography, relying heavily on computational models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2A25; OR2A25P; OR2A27; Olfactory receptor 2A25; Olfactory receptor 2A27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR2A25
Target Protein Sequence
MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL KRMLEKKRTS
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19023099
  2. Observational study of gene-disease association. (HuGE Navigator) PMID: 17975119
Database Links

HGNC: 19562

KEGG: hsa:392138

STRING: 9606.ENSP00000386167

UniGene: Hs.553787

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2A25 and how is it classified?

Olfactory receptor 2A25 (OR2A25) is a member of the olfactory receptor family, which constitutes the largest gene superfamily in humans. It is classified as a Class A G-protein coupled receptor (GPCR) within the olfactory receptor family . OR2A25 is located on chromosome 7, specifically at position 143402246-143403178 . Like other olfactory receptors, it belongs to the G-protein coupled receptor 1 family , which is characterized by a seven-transmembrane domain structure. This receptor is involved in odorant recognition, contributing to the human sense of smell through signal transduction mechanisms typical of GPCRs.

What genomic and protein identifiers are associated with OR2A25?

OR2A25 is associated with several standardized identifiers across different biological databases. The gene is identified in the Ensembl database with the ID ENSG00000221933 . At the protein level, it is referenced in UniProt with the identifiers B2RNC9 (SubName: Full=Olfactory receptor, family 2, subfamily A, member 25) and A4D2G3 (RecName: Full=Olfactory receptor 2A25) . The nucleotide sequence is cataloged in RefSeq as NM_001004488, described as "Homo sapiens olfactory receptor, family 2, subfamily A, member 25 (OR2A25), mRNA" . Additional identifiers include EntrezGene ID "OR2A25" and RefSeq protein ID NP_001004488 . These standardized identifiers facilitate cross-platform research and data integration for researchers studying this receptor.

How does OR2A25 compare to other olfactory receptors in terms of structure and function?

OR2A25 shares structural characteristics with other olfactory receptors, including the typical seven-transmembrane domain architecture of G-protein coupled receptors. Like other ORs, it contains specific protein domains identified in databases such as InterPro, including IPR000725 (Olfact_rcpt), IPR000276 (GPCR_Rhodpsn), and IPR017452 (GPCR_Rhodpsn_supfam) .

What expression systems are optimal for recombinant OR2A25 production?

For recombinant expression of olfactory receptors including OR2A25, several expression systems can be considered based on research with similar receptors. While the search results don't specify the optimal expression system for OR2A25 specifically, we can draw from methodologies used for similar olfactory receptors.

Cell-free expression systems have been successfully employed for other olfactory receptors, such as OR5AL1, resulting in full-length recombinant proteins with high purity (≥85%) . Wheat germ expression systems have also been utilized for olfactory receptor fragments, as demonstrated with OR2A2 . For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems like HEK293 cells may be preferred, though they typically yield lower protein quantities.

The choice of expression system should be guided by the specific research objectives: cell-free systems for structural studies requiring higher yields, mammalian systems for functional assays requiring proper folding and trafficking, and wheat germ for specific protein fragments.

What purification strategies are most effective for obtaining high-purity OR2A25?

Purification of recombinant OR2A25, like other membrane proteins, presents significant challenges due to its hydrophobic nature and seven-transmembrane structure. Based on approaches used for similar olfactory receptors, a multi-step purification strategy is recommended.

For initial capture, immobilized metal affinity chromatography (IMAC) using a histidine tag is commonly employed. This should be followed by size exclusion chromatography to eliminate aggregates and achieve higher purity. Throughout the purification process, it's crucial to maintain the receptor in a suitable detergent environment to prevent aggregation and denaturation.

The quality of purified OR2A25 should be assessed using SDS-PAGE to confirm size and purity, similar to the analysis performed for other recombinant olfactory receptors . For applications requiring higher purity, additional chromatographic steps such as ion exchange chromatography may be implemented.

How can researchers effectively validate the functionality of recombinant OR2A25?

Validating the functionality of recombinant OR2A25 requires assessing its ability to bind ligands and activate downstream signaling pathways. Several complementary approaches are recommended:

  • Ligand binding assays: Using techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure direct binding between the receptor and potential ligands.

  • Calcium mobilization assays: Heterologous expression of OR2A25 in a cell line along with the appropriate G-protein subunits, followed by measurement of calcium flux upon ligand stimulation using fluorescent calcium indicators.

  • cAMP assays: Measuring cyclic AMP production following receptor activation, as olfactory receptors typically couple to Gαolf, leading to adenylyl cyclase activation.

  • Bioluminescence resonance energy transfer (BRET): To assess receptor-G-protein coupling efficiency upon ligand binding.

For all functional assays, positive and negative controls are essential, including cells expressing known functional olfactory receptors and mock-transfected cells. Identifying specific ligands for OR2A25 may require screening various odorant panels, as seen in studies of other olfactory receptors such as OR5A1, which responds to β-ionone .

How can genetic variation in OR2A25 be analyzed and correlated with olfactory phenotypes?

Analyzing genetic variation in OR2A25 and correlating it with olfactory phenotypes requires a comprehensive approach combining genomic analysis with sensory testing:

  • Sequencing strategies: Targeted sequencing of the OR2A25 coding region can identify single nucleotide polymorphisms (SNPs) and other variants. Whole genome sequencing can detect larger structural variations, including copy number variations (CNVs) that have been shown to frequently affect olfactory receptor genes .

  • CNV detection: High-resolution oligonucleotide tiling microarrays have been successfully employed to detect CNVs across olfactory receptor loci . For OR2A25, quantitative PCR can validate identified CNVs, similar to approaches used for other olfactory receptors .

  • Phenotype correlation: Olfactory psychophysical testing should be performed with potential ligands, assessing parameters such as detection threshold, intensity perception, and pleasantness, as done in studies correlating genetic variants with perception of specific odorants like β-ionone and 3M2H .

  • Statistical analysis: Genome-wide association studies (GWAS) or targeted association studies can identify correlations between OR2A25 variants and perceptual phenotypes. Meta-analysis approaches combining multiple cohorts can enhance statistical power, as demonstrated in previous olfactory genetics research .

This integrated approach can reveal whether specific variants in OR2A25, such as missense SNPs (similar to the functionally significant D183N in OR5A1 ), correlate with altered olfactory perception.

What is known about the ligand specificity of OR2A25 and how can it be determined?

  • Heterologous expression systems: OR2A25 can be expressed in systems such as HEK293 cells or Xenopus oocytes along with appropriate signaling components (Gαolf, CNGA2, etc.).

  • High-throughput screening: A diverse panel of odorants can be screened against the expressed receptor using calcium imaging or cAMP assays to identify potential ligands.

  • Dose-response analysis: For identified hits, dose-response relationships should be established to determine EC50 values and efficacy parameters.

  • Structural modeling and mutagenesis: Homology modeling based on known GPCR structures can predict ligand binding pockets. Site-directed mutagenesis of predicted binding residues, followed by functional testing, can validate these predictions and identify key residues for ligand interaction.

  • Comparative analysis: Examining responses of closely related olfactory receptors in subfamily 2A may provide insights into shared ligand preferences.

This systematic approach has successfully identified ligands for other olfactory receptors, such as β-ionone for OR5A1 , and can be adapted for OR2A25 deorphanization.

How does OR2A25 relate to the evolution of the human olfactory receptor repertoire?

Understanding OR2A25's evolutionary context requires comparative genomic analysis across species and within human populations:

  • Ortholog identification: Determining whether OR2A25 has orthologs in other primates and mammals can reveal its evolutionary age and conservation.

  • Selection pressure analysis: Calculating the ratio of nonsynonymous to synonymous substitutions (dN/dS) in the OR2A25 sequence across species can indicate whether the receptor has been under positive, negative, or neutral selection.

  • CNV distribution: Analyzing the distribution of copy number variations affecting OR2A25 across human populations may reveal evolutionary trends. Research has shown that CNVs are generally more common among OR pseudogenes than intact genes, suggesting selective constraints on functional receptors .

  • Paralog comparisons: Examining the relationship between OR2A25 and its closest human paralogs may provide insights into duplication events and functional divergence. Previous research indicates that olfactory receptors with close human paralogs are enriched for CNVs .

  • Human-specific changes: Determining whether any structural or regulatory changes in OR2A25 are human-specific could relate to the known diminution of the human olfactory repertoire compared to other mammals .

This evolutionary analysis would place OR2A25 within the broader context of human olfactory receptor evolution, characterized by a reduced repertoire size and high pseudogenization rate (∼55%) .

What are common challenges in functional expression of OR2A25 and how can they be overcome?

Functional expression of olfactory receptors, including OR2A25, presents several challenges:

  • Poor plasma membrane trafficking: Olfactory receptors often show retention in the endoplasmic reticulum. This can be addressed by:

    • Using specialized expression vectors containing trafficking enhancement sequences

    • Co-expression with accessory proteins like RTP1S and Ric-8B

    • Creating fusion constructs with well-expressed membrane proteins

    • Optimizing codon usage for the expression system

  • Protein instability: The hydrophobic nature of OR2A25 can lead to misfolding and aggregation. Strategies to improve stability include:

    • Expression at reduced temperatures

    • Addition of chemical chaperones to the culture medium

    • Incorporation of stabilizing mutations identified through directed evolution

  • Low expression levels: To enhance expression yields:

    • Test multiple cell lines and expression systems

    • Optimize induction conditions

    • Consider inducible expression systems to minimize toxicity

  • Functional verification challenges: Without known ligands, confirming functionality is difficult. Approaches include:

    • Using chimeric G-proteins to channel signaling through measurable pathways

    • Employing multiple complementary functional assays

    • Incorporating positive controls with known ligand-receptor pairs

These strategies have been successfully applied to other olfactory receptors and can be adapted specifically for OR2A25 expression.

How can researchers differentiate between specific and non-specific binding in OR2A25 ligand discovery?

Differentiating specific from non-specific binding is crucial in OR2A25 ligand discovery:

  • Competition assays: If a ligand is identified, unlabeled ligand should compete with labeled ligand in a concentration-dependent manner, following saturable binding kinetics.

  • Negative controls: Include:

    • Mock-transfected cells expressing all components except OR2A25

    • Cells expressing an unrelated olfactory receptor

    • Testing the candidate ligand against multiple unrelated olfactory receptors

  • Dose-response relationships: Specific ligands typically show sigmoidal dose-response curves with defined EC50 values, while non-specific effects often present linear or irregular responses.

  • Receptor mutagenesis: Targeted mutations in predicted binding pocket residues should alter binding affinity of true ligands without affecting non-specific interactions.

  • Structure-activity relationship (SAR) studies: Testing structurally related compounds should reveal patterns of activity consistent with specific binding site interactions.

  • Functional coupling assessment: Verify that ligand binding leads to appropriate downstream signaling events expected from GPCR activation.

These rigorous controls and analytical approaches help distinguish genuine OR2A25 ligands from compounds producing non-specific effects, ensuring the validity of ligand discovery results.

How might OR2A25 contribute to non-olfactory functions in the human body?

While olfactory receptors are primarily known for their role in odor detection, emerging research suggests they may have non-olfactory functions:

  • Ectopic expression analysis: Systematic examination of OR2A25 expression in non-olfactory tissues through techniques such as RNA-seq, qPCR, and immunohistochemistry could reveal unexpected expression patterns.

  • Physiological role investigation: In tissues where OR2A25 is expressed, functional studies using receptor knockdown or overexpression approaches could identify physiological processes influenced by this receptor.

  • Metabolic function assessment: Some olfactory receptors have been implicated in metabolic regulation. Research could investigate whether OR2A25 responds to metabolites rather than conventional odorants, potentially serving as a metabolic sensor.

  • Development and regeneration: Exploration of OR2A25 expression during development or in regenerative processes might reveal roles beyond olfaction, similar to other GPCRs involved in tissue homeostasis.

  • Pathological associations: Bioinformatic analyses of disease databases and genome-wide association studies could identify any associations between OR2A25 variants and human diseases unrelated to olfaction.

These research directions would contribute to the expanding field of ectopic olfactory receptor functions, which has already revealed surprising roles for some olfactory receptors in processes such as muscle regeneration, sperm chemotaxis, and cancer progression.

What potential exists for using OR2A25 in biosensor applications?

Olfactory receptors offer unique potential for biosensor development due to their sensitive and specific ligand detection capabilities. For OR2A25:

  • Cell-based biosensors: Engineered cells expressing OR2A25 coupled to reporter systems (fluorescent, luminescent, or electrical) could detect specific ligands. The sensitivity and specificity of such systems would depend on identifying high-affinity ligands for OR2A25.

  • Nanodisc and liposome incorporation: Purified OR2A25 could be incorporated into nanodiscs or liposomes attached to transducer elements such as field-effect transistors, quartz crystal microbalances, or surface plasmon resonance platforms.

  • Artificial cell membrane systems: Technologies like ion channel-coupled receptors (ICCR) could link OR2A25 activation directly to measurable electrical signals.

  • Receptor array development: OR2A25 could be included in arrays of multiple olfactory receptors to create pattern recognition-based biosensors capable of detecting complex mixtures or discriminating between similar compounds.

  • Stability enhancement: For practical biosensor applications, stability of OR2A25 would need to be enhanced through methods such as directed evolution, computational design of stabilizing mutations, or chemical modification.

The development of such biosensors would require thorough characterization of OR2A25's ligand specificity and the creation of optimized expression and immobilization protocols to maintain receptor functionality outside the cellular environment.

What are the most significant unanswered questions regarding OR2A25?

Despite advances in olfactory receptor research, several critical questions about OR2A25 remain unanswered:

  • Ligand specificity: The chemical compounds specifically recognized by OR2A25 have not been definitively established, leaving its precise role in olfactory perception undefined.

  • Genetic variation impact: How common variants and copy number variations affecting OR2A25 influence olfactory perception across human populations remains to be fully characterized.

  • Structure-function relationships: The specific structural features of OR2A25 that determine its ligand selectivity and signaling properties have not been thoroughly mapped.

  • Non-olfactory functions: Potential roles of OR2A25 outside the olfactory system, if any, await discovery and characterization.

  • Regulatory mechanisms: The transcriptional, translational, and post-translational mechanisms regulating OR2A25 expression and function remain poorly understood.

  • Evolutionary significance: The selective pressures that have shaped OR2A25 during human evolution and its relation to the broader changes in the human olfactory repertoire require further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.