Recombinant Human Olfactory receptor 2A2 (OR2A2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Olfaction

As an odorant receptor, OR2A2 detects volatile chemical compounds, initiating signal transduction via Gₒₗf proteins. Activation triggers cAMP-mediated calcium influx, depolarizing olfactory neurons . While its specific ligands are unknown, OR2A2’s broad ligand selectivity aligns with combinatorial odor-coding principles observed in other ORs .

Research Applications

OR2A2 is commercially available in two recombinant forms:

PropertyAbcam (ab166553) Cusabio (CSB-CF746918HU)
Expression SystemWheat germE. coli
Purity>70% (SDS-PAGE)Not specified
ApplicationsELISA, Western BlotImmunoassays, structural studies
Storage-80°C (lyophilized)-80°C (solution)

Antibody tools for OR2A2 detection:

  • Clone 4B10 (OAAL00999): Mouse monoclonal IgG2a targeting the 261–318 peptide region .

Expression and Localization

  • Native tissue: Predominantly expressed in olfactory epithelium .

  • Ectopic expression: Successfully produced in E. coli and wheat germ systems, though functional reconstitution in mammalian cells (e.g., Hana3A) remains unreported .

  • Subcellular localization: Membrane-bound in heterologous systems, consistent with GPCR trafficking .

Research Challenges

  • Deorphanization: No activating ligands identified to date, unlike related receptors (e.g., OR2W3 activated by nerol ).

  • Structural data: No resolved crystal structures; homology models rely on bovine rhodopsin templates .

  • Functional assays: Requires co-expression with chaperones (RTP1/2) for proper folding in heterologous systems .

Biological and Clinical Relevance

  • Evolutionary conservation: Part of the primate-specific OR2A subfamily, pseudogenized in some lineages .

  • Non-olfactory roles: While ORs like OR51E2 regulate sperm chemotaxis , OR2A2’s extra-nasal functions are unexplored.

  • Disease associations: No direct links reported, though metalloprotein dysfunction in ORs may contribute to neurodegenerative disorders .

Future Directions

  • Ligand screening: High-throughput assays using M2OR database frameworks .

  • Structural studies: Cryo-EM analysis to resolve activation mechanisms.

  • Therapeutic potential: GPCR-targeted drug discovery for anosmia or metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
OR2A2; OR2A17P; OR2A2P; Olfactory receptor 2A2; Olfactory receptor 2A17; Olfactory receptor OR7-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2A2
Target Protein Sequence
MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSKLHTPMYF FLSHLAIIDMSYASNNVPKMLANLMNQKRTISFVPCIMQTFLYLAFAVTECLILVVMSYD RYVAICHPFQYTVIMSWRVCTILVLTSWSCGFALSLVHEILLLRLPFCGPRDVNHLFCEI LSVLKLACADTWVNQVVIFATCVFVLVGPLSLILVSYMHILGAILKIQTKEGRIKAFSTC SSHLCVVGLFFGIAMVVYMVPDSNQREEQEKMLSLFHSVFNPMLNPLIYSLRNAQLKGAL HRALQRKRSMRTVYGLCL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8230

KEGG: hsa:442361

STRING: 9606.ENSP00000386209

UniGene: Hs.553841

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.