Recombinant Human Olfactory receptor 2A4 (OR2A4)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

OR2A4 belongs to the G-protein-coupled receptor (GPCR) family and is encoded by the OR2A4 gene located on chromosome 6 . It features a 7-transmembrane domain structure and is primarily involved in odorant detection through cAMP-mediated signaling pathways . Recombinant OR2A4 retains these structural and functional properties, enabling in vitro studies of ligand interactions and downstream signaling.

Key Features of Recombinant OR2A4:

PropertyDetails
UniProt IDO95047
Expression SystemE. coli (in vitro)
Sequence Length310 amino acids (1-310 residues)
TagN-terminal 10xHis-tag for purification
Storage-20°C (short-term); -80°C for long-term stability

Table 1: Odorant Ligands and Signaling Pathways

OdorantFunction in Keratinocytes/Hair FolliclesSignaling Pathways ActivatedReference
SandalorePromotes proliferation, migration, wound healingcAMP, Erk1/2, p38 MAPK
BrahmanolEnhances hair growth; delays apoptosisPI3K/AKT/NF-κB, ↓ p53
CyclohexylsalicylateInduces cytokinesis and IL-1 secretionAKT, Chk-2 phosphorylation
Isononyl alcoholActivates cAMP pathwayCalcium ion signaling

a) Skin Physiology and Wound Healing

  • Keratinocyte Proliferation: OR2A4 activation by sandalore increases proliferation and migration in HaCaT cells via Erk1/2 and p38 MAPK phosphorylation .

  • Hair Follicle Regulation: Stimulation with brahmanol upregulates anti-apoptotic pathways (PI3K/AKT/NF-κB) and prolongs the hair growth phase (anagen) .

b) Therapeutic Potential

  • Atopic Dermatitis (AD): OR2A4/7 (a related isoform) activation elevates ATP and IL-1β in keratinocytes, suggesting a role in inflammatory skin conditions .

  • Melanoma: OR51B5 (a homolog) shows anti-proliferative effects in melanoma cells, hinting at broader oncological applications .

Challenges and Future Directions

  • Signaling Complexity: OR2A4’s ectopic signaling in non-olfactory tissues (e.g., skin) involves tissue-specific pathways distinct from nasal olfactory epithelia .

  • Therapeutic Development: Small-molecule agonists/antagonists (e.g., phenirat, oxyphenylon) are under investigation for dermatological and hair disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
OR2A4; OR2A10; Olfactory receptor 2A4; Olfactory receptor 2A10; Olfactory receptor OR6-37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR2A4
Target Protein Sequence
MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFRTC FSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Proliferation tests, ELISA and kinase array indicated that OR2A4/7 and CHS play important roles in the proliferation of HaCaT cells and keratinocytes. PMID: 27315375
Database Links

HGNC: 14729

KEGG: hsa:79541

STRING: 9606.ENSP00000319546

UniGene: Hs.486488

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Human Olfactory Receptor 2A4?

OR2A4 is a G-protein coupled receptor belonging to the large family of olfactory receptors. It consists of 310 amino acids with a characteristic seven-transmembrane domain structure. The full amino acid sequence is: MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYFFLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYDLYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEILAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFRTCFSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTLKRVLGVERAL . Like other olfactory receptors, it contains conserved motifs in the transmembrane domains, particularly in TM3 (containing sequences like MAYDRYVAIC and its variants) and TM6 (containing sequences like KAFSTCASH) that are characteristic of this receptor family .

How does OR2A4 fit within the human olfactory receptor gene family classification?

OR2A4 is one of the 339 intact olfactory receptor genes identified in the human genome (alongside 297 pseudogenes) . The human OR family is organized into 172 subfamilies based on sequence similarity, with members of the same subfamily sharing ≥60% amino acid sequence identity . OR2A4 is also known as OR2A10 and belongs to a specific OR subfamily that likely recognizes structurally related odorants . This classification is functionally relevant because ORs within the same subfamily typically detect chemically similar compounds, following the combinatorial coding principle where each OR recognizes multiple odorants and each odorant is detected by multiple ORs .

What expression systems are commonly used for producing recombinant OR2A4?

Recombinant Human OR2A4 is commonly expressed using in vitro E. coli expression systems, as indicated in commercial preparations . When expressing olfactory receptors, researchers often add specific tags (such as the N-terminal 10xHis-tag used in commercial preparations) to facilitate purification and detection . Alternative expression systems that have been used for other olfactory receptors include cell-free expression systems (as seen with OR5AL1) and mammalian cell lines. The choice of expression system influences protein yield, proper folding, and post-translational modifications, which are critical considerations for functional studies of membrane proteins like ORs.

What are the optimal buffer conditions for maintaining OR2A4 stability?

For recombinant OR2A4, Tris/PBS-based buffers with pH 8.0 containing 6% Trehalose are commonly used for protein stabilization . The addition of Trehalose is particularly important as it acts as a cryoprotectant during freeze-thaw cycles and helps maintain protein structure. When working with membrane proteins like olfactory receptors, detergent selection is also critical - mild non-ionic detergents that mimic the membrane environment while allowing solubility are often preferred. Researchers should avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity . For extended storage, aliquoting the protein and maintaining it at -20°C/-80°C is recommended to preserve functionality.

How can researchers verify the proper folding and functionality of recombinant OR2A4?

Verifying proper folding and functionality of recombinant OR2A4 requires multiple complementary approaches:

  • Structural assessment: Circular dichroism (CD) spectroscopy can verify secondary structure elements characteristic of GPCRs.

  • Ligand binding assays: Using predicted or known ligands in binding assays to test receptor functionality.

  • Calcium imaging: When expressed in appropriate cell systems, functional ORs respond to odorant binding with calcium influx that can be measured using fluorescent calcium indicators.

  • cAMP assays: Since ORs signal through G proteins that activate adenylyl cyclase, measuring cAMP production following exposure to potential ligands confirms functionality.

  • Surface expression verification: Immunocytochemistry using antibodies against tags or the receptor itself can confirm proper trafficking to the cell membrane.

The combinatorial approach provides comprehensive evidence of proper receptor expression and function, as single methods alone may not capture all aspects of OR functionality.

What computational approaches are useful for predicting OR2A4 ligands?

Computational approaches for predicting OR2A4 ligands leverage sequence relationships within the olfactory receptor family. Since members of the same OR subfamily (sharing ≥60% sequence identity) typically recognize structurally related odorants, researchers can use comparative sequence analysis to make initial predictions . More sophisticated methods include:

  • Homology modeling: Building 3D structural models based on known GPCR structures and identifying potential ligand binding pockets.

  • Molecular docking: Virtual screening of compound libraries against the modeled receptor structure.

  • Machine learning approaches: Training algorithms on known OR-ligand pairs to predict new interactions.

  • Phylogenetic analysis: Comparing OR2A4 with evolutionarily related ORs that have known ligands.

  • Analysis of conserved binding residues: Identifying key amino acids in transmembrane domains that might interact with ligands.

These computational predictions should always be validated experimentally, as the relationship between OR sequence and ligand preference involves complex structural interactions that are not fully understood.

How can OR2A4 function be studied in heterologous expression systems?

Studying OR2A4 function in heterologous expression systems requires addressing several challenges specific to olfactory receptors:

  • Cell line selection: HEK293 cells are commonly used due to their high transfection efficiency and low endogenous GPCR expression.

  • Receptor trafficking enhancement: Co-expression with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) significantly improves surface expression of ORs.

  • Promoter optimization: Using strong promoters like CMV can increase expression levels.

  • Functional coupling verification: Ensuring the receptor couples to endogenous G proteins or co-expressing appropriate G protein subunits.

  • Readout system selection: Incorporating reporter systems such as luciferase under cAMP-responsive elements or using FRET-based sensors for real-time activity monitoring.

Success in heterologous expression is measured by demonstrating dose-dependent responses to potential ligands, which can be detected through calcium imaging, cAMP assays, or electrophysiological recordings depending on the specific research question .

What evidence suggests extra-nasal functions for olfactory receptors like OR2A4?

Research has revealed that olfactory receptors function beyond their traditional role in olfaction, with expression in multiple tissues throughout the body. While specific functions of OR2A4 outside the olfactory epithelium are still being investigated, studies on related olfactory receptors provide insight into potential roles:

  • Hair growth regulation: The olfactory receptor OR2AT4 is expressed in human hair follicles, particularly in the outer root sheath, where it regulates hair growth. Stimulation with a synthetic sandalwood odorant (Sandalore) prolongs the growth phase by decreasing apoptosis and increasing IGF-1 production .

  • Cell proliferation: Several olfactory receptors, including OR2AT4, have been shown to stimulate keratinocyte proliferation in the skin .

  • Physiological regulation: ORs in non-olfactory tissues participate in chemosensation that regulates various physiological processes.

These findings suggest that OR2A4 might similarly have tissue-specific functions beyond olfaction, potentially responding to endogenous ligands rather than external odorants in these contexts .

How does the genomic organization of OR2A4 relate to its evolution and function?

The genomic organization of OR genes, including OR2A4, provides insights into their evolution and functional specialization:

  • Clustered arrangement: Human OR genes are distributed across 51 loci on 21 chromosomes, with OR2A4 residing within one of these clusters .

  • Subfamily co-localization: 79% of OR subfamilies with multiple members are encoded by genes at a single locus, highlighting the importance of local gene duplication in OR evolution .

  • Functional implications: Different chromosomal loci encode different subfamilies of ORs and might therefore be involved in the perception of different odors. This organization suggests that OR2A4's genomic context may reflect its specialized function in detecting specific odorant structures .

  • Evolutionary conservation: Comparative genomic analysis between human OR genes and those of other species can reveal evolutionary pressures and functional importance.

This genomic organization reflects the evolutionary history of duplications and diversification that has enabled the olfactory system to detect a wide range of odorants .

What are the major challenges in expressing functional olfactory receptors for research?

Expressing functional olfactory receptors presents several technical challenges:

  • Poor membrane trafficking: Olfactory receptors often remain trapped in the endoplasmic reticulum rather than reaching the cell surface.

  • Low stability: As membrane proteins, ORs can be unstable when removed from their native lipid environment.

  • Conformational heterogeneity: ORs may adopt multiple conformations, only some of which are functionally relevant.

  • Post-translational modifications: Proper glycosylation and other modifications may be required for function but difficult to reproduce in heterologous systems.

  • Detergent sensitivity: Finding detergents that solubilize the receptor while maintaining its native structure is challenging.

These challenges can be addressed through strategies such as adding accessory proteins, using specialized expression hosts, optimizing codon usage, and creating fusion constructs with well-expressed proteins .

How can researchers determine the specificity profile of OR2A4?

Determining the specificity profile of OR2A4 requires systematic testing against diverse odorant panels:

  • High-throughput screening: Testing the receptor against large libraries of odorants to identify active compounds.

  • Structure-activity relationship analysis: Testing structurally related compounds to define molecular features important for activation.

  • Dose-response experiments: Determining EC50 values for active compounds to quantify relative potencies.

  • Antagonist identification: Testing for compounds that block activation by known agonists.

  • Receptor mutagenesis: Creating point mutations in predicted binding sites to confirm their importance for specific odorant recognition.

Data from these experiments can be visualized as specificity maps that illustrate the chemical space recognized by OR2A4, helping to define its "receptive field" within the combinatorial coding scheme of olfaction .

What methodologies can overcome the issue of low surface expression of ORs in heterologous systems?

Low surface expression of olfactory receptors in heterologous systems is a significant challenge that can be addressed through several methodologies:

  • Co-expression with accessory proteins: Receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) significantly improve trafficking of ORs to the cell surface.

  • N-terminal modifications: Adding well-expressed protein tags such as rhodopsin or 5-HT3A receptor N-terminal sequences can enhance trafficking.

  • Leucine-rich repeat consensus motifs: Incorporating these motifs can improve surface expression.

  • Temperature manipulation: Culturing transfected cells at lower temperatures (30-32°C) can improve folding and trafficking.

  • Chemical chaperones: Compounds like glycerol, DMSO, or 4-phenylbutyric acid can stabilize protein folding.

  • Codon optimization: Adapting the codon usage to the expression host can improve translation efficiency.

These approaches can be used individually or in combination to achieve sufficient surface expression for functional studies, with success measured by immunofluorescence staining of non-permeabilized cells or functional assays .

How should researchers interpret contradictory results in OR ligand identification studies?

Contradictory results in OR ligand identification studies are common and require careful interpretation:

  • Expression system differences: Different heterologous systems may produce variations in receptor conformation, G-protein coupling, or downstream signaling.

  • Assay sensitivity variances: Different detection methods have varying sensitivities and may measure different aspects of receptor activation.

  • Concentration dependence: Testing at different concentrations may yield apparently contradictory results as some ORs show complex dose-response relationships.

  • Receptor polymorphisms: Genetic variants of the same receptor may have different ligand specificities.

  • Accessory protein variations: Differences in co-expressed accessory proteins can affect receptor function.

To resolve contradictions, researchers should:

  • Systematically compare methodologies used in different studies

  • Perform side-by-side comparisons using standardized protocols

  • Test receptor variants and accessory protein combinations

  • Consider the possibility that multiple ligand binding sites exist on the receptor

This systematic approach helps distinguish true biological variations from methodological artifacts .

What statistical approaches are most appropriate for analyzing OR2A4 activation data?

Analyzing OR2A4 activation data requires appropriate statistical approaches:

  • Dose-response curve fitting: Nonlinear regression to determine EC50 values and maximum response amplitudes.

  • Normalization strategies: Accounting for variations in expression levels by normalizing to positive controls or surface expression measurements.

  • Multiple comparison corrections: When testing many compounds, corrections like Bonferroni or false discovery rate (FDR) are essential.

  • Principal component analysis: Useful for identifying patterns in responses to multiple ligands.

  • Hierarchical clustering: Can reveal relationships between structurally similar ligands and their receptor responses.

  • Bayesian methods: Particularly valuable when incorporating prior knowledge about receptor-ligand interactions.

For each experiment, appropriate negative controls (vector-transfected cells, known non-ligands) and positive controls (known ligands for related receptors) should be included to establish the dynamic range and specificity of the assay .

How can researchers differentiate between direct and indirect effects in OR2A4 stimulation experiments?

Differentiating between direct and indirect effects in OR activation experiments is crucial for accurate interpretation:

  • Competitive binding assays: Using labeled known ligands to demonstrate direct competition by test compounds.

  • Heterologous expression in minimal systems: Using cells with limited endogenous signaling to reduce indirect effects.

  • Receptor mutagenesis: Creating binding site mutations that specifically abolish direct interactions while preserving general receptor function.

  • Time-course analysis: Direct effects typically occur more rapidly than indirect effects.

  • Blocking experiments: Using specific pathway inhibitors to rule out indirect mechanisms.

  • In vitro reconstitution: Testing with purified receptor in artificial membrane systems minimizes cellular indirect effects.

These approaches can help establish that observed responses are due to direct ligand-receptor interactions rather than off-target effects or downstream signaling events triggered by other mechanisms .

How does OR2A4 compare structurally and functionally to other characterized olfactory receptors?

Comparative analysis of OR2A4 with other characterized olfactory receptors reveals important structural and functional insights:

  • Sequence homology: OR2A4 shares the characteristic seven-transmembrane domain structure with other ORs, with highest sequence similarity to members of its own subfamily .

  • Conserved motifs: Like other ORs, OR2A4 contains the conserved MAYDRYVAIC (TM3) and KAFSTCASH (TM6) motifs with some variations that may influence ligand specificity .

  • Comparative ligand recognition: While specific OR2A4 ligands may not be fully characterized, other ORs like OR2AT4 respond to synthetic sandalwood odorants, suggesting that the OR2A subfamily may recognize related chemical structures .

  • G-protein coupling: OR2A4 belongs to the G-protein coupled receptor 1 family, coupling to similar G proteins as other ORs to initiate intracellular signaling cascades .

  • Extra-nasal functions: Like OR2AT4, which regulates hair growth, OR2A4 may have functions beyond olfaction that depend on its specific expression pattern in non-olfactory tissues .

This comparative analysis helps predict OR2A4 functions based on better-characterized family members while highlighting its unique features .

What can we learn from studying OR2A4 within its subfamily context?

Studying OR2A4 within its subfamily context provides valuable insights:

  • Ligand prediction: Members of the same subfamily (sharing ≥60% sequence identity) typically recognize structurally related odorants, allowing researchers to predict potential OR2A4 ligands based on known ligands of related receptors .

  • Functional evolution: Comparing OR2A4 with closely related ORs reveals evolutionary patterns of gene duplication and specialization that reflect adaptation to different chemical environments.

  • Binding site conservation: Analysis of conserved and variable residues within the subfamily helps identify amino acids critical for shared ligand features versus those determining specificity differences.

  • Expression pattern comparison: Differences in expression patterns among subfamily members may indicate functional specialization for different tissues or developmental stages.

  • Receptor cooperativity: Some evidence suggests that related ORs may function cooperatively in detecting complex odorant mixtures.

This subfamily-based approach leverages evolutionary relationships to accelerate understanding of OR2A4 function and place it within the broader context of olfactory perception .

How do extra-nasal functions of olfactory receptors inform potential applications of OR2A4 research?

The discovery of extra-nasal functions of olfactory receptors opens new potential applications for OR2A4 research:

  • Therapeutic development: OR2AT4 activation promotes hair growth, suggesting that other ORs like OR2A4 might have similar tissue-specific functions that could be therapeutically targeted .

  • Diagnostic biomarkers: Altered expression of specific ORs in certain diseases could serve as diagnostic indicators.

  • Physiological regulation: ORs may sense endogenous metabolites or signaling molecules to regulate physiological processes.

  • Drug delivery systems: Understanding tissue-specific OR expression could enable targeted drug delivery approaches.

  • Regenerative medicine: If OR2A4 influences cell proliferation or differentiation in specific tissues, it could have applications in tissue regeneration.

These potential applications highlight the importance of characterizing OR2A4 expression patterns in multiple tissues and identifying its endogenous ligands beyond traditional odorants .

What emerging technologies could advance OR2A4 functional characterization?

Several emerging technologies hold promise for advancing OR2A4 functional characterization:

  • Cryo-electron microscopy: Recent advances in cryo-EM resolution may enable structural determination of ORs, providing crucial insights into ligand binding mechanisms.

  • Artificial cell membrane systems: Nanodiscs and lipoprotein particles provide more native-like environments for OR functional studies.

  • Organ-on-chip technology: Microfluidic devices that mimic tissue environments could allow study of OR2A4 in more physiologically relevant contexts.

  • CRISPR-based approaches: Precise genome editing enables creation of reporter systems and knockout models for studying OR function in vivo.

  • Single-cell RNA sequencing: Detailed expression profiling can identify specific cell types expressing OR2A4 in various tissues.

  • Advanced computational methods: Machine learning approaches integrating structural and functional data can improve ligand prediction.

  • Biosensor development: Creating OR-based biosensors for high-throughput screening and environmental monitoring.

These technologies will help overcome current limitations in OR research and accelerate functional characterization .

What are the most promising directions for applying OR2A4 research findings?

The most promising directions for applying OR2A4 research findings include:

  • Personalized olfactory medicine: Understanding how genetic variations in OR2A4 affect olfactory perception could inform personalized approaches to olfactory disorders.

  • Non-olfactory physiological regulation: If OR2A4 has roles in specific tissues beyond the nose, targeting these functions could lead to novel therapeutic approaches.

  • Biosensing applications: Engineered systems incorporating OR2A4 could detect specific chemicals for environmental monitoring or quality control.

  • Understanding evolutionary adaptation: Comparative studies of OR2A4 across species can reveal evolutionary pressures on olfactory perception.

  • Developmental biology: Investigating OR2A4's role in tissue development and regeneration could inform regenerative medicine approaches.

  • Chemical ecology: Understanding the natural ligands of OR2A4 contributes to our knowledge of human-environment chemical interactions.

These applications highlight the interdisciplinary potential of OR2A4 research beyond basic olfactory science .

How might integration of multi-omics data enhance our understanding of OR2A4 function?

Integration of multi-omics data offers powerful approaches to enhance our understanding of OR2A4 function:

  • Genomics and transcriptomics: Combining genomic analysis of OR2A4 location and structure with tissue-specific expression data to map where and when the receptor functions.

  • Proteomics: Identifying OR2A4 interaction partners in different tissues to understand tissue-specific signaling networks.

  • Metabolomics: Discovering endogenous metabolites that may act as ligands for OR2A4 in non-olfactory contexts.

  • Structural biology: Integrating structural predictions with functional data to understand the molecular basis of ligand recognition.

  • Systems biology: Building comprehensive models of OR2A4 signaling networks in different cellular contexts.

  • Comparative genomics: Analyzing OR2A4 evolution across species to identify functionally important regions under evolutionary constraint.

This integrated approach can reveal connections between genetic variation, receptor structure, expression patterns, and functional outcomes that would not be apparent from any single data type .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.