Recombinant Human Olfactory receptor 2A5 (OR2A5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2A5; OR2A26; OR2A8; Olfactory receptor 2A5; Olfactory receptor 2A26; Olfactory receptor 2A8; Olfactory receptor 7-138/7-141; OR7-138; OR7-141
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2A5
Target Protein Sequence
MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWLDSRLHTPMYF FLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQTFLYMAFAHTECLILVMMSY DRYMAICHPLQYSVIMRWGVCTVLAVTSWACGSLLALVHVVLILRLPFCGPHEINHFFCE ILSVLKLACADTWLNQVVIFAASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFST CSSHLCMVGLFFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGA LKRVLWKQRSK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8232

KEGG: hsa:393046

STRING: 9606.ENSP00000386208

UniGene: Hs.553793

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2A5 and what is its primary function in human physiology?

OR2A5 (Olfactory receptor 2A5) is a G protein-coupled receptor (GPCR) belonging to the largest transmembrane protein family in the human genome. It plays a crucial role in the detection and recognition of volatile odorant molecules in the environment . This receptor is involved in the initial stages of the olfactory signaling cascade that ultimately leads to odor perception.

OR2A5 is also known by alternative names including Olfactory receptor 2A26, Olfactory receptor 2A8, and Olfactory receptor 7-138/7-141 (OR7-138, OR7-141) . The receptor is primarily expressed in olfactory sensory neurons (OSNs) but has also been detected in other tissues, which suggests potential non-olfactory functions .

How does OR2A5 relate to other olfactory receptors in the human genome?

OR2A5 is one of approximately 400 functional olfactory receptors in humans (out of ~800 OR genes, with the remainder being pseudogenes). It belongs to the OR2A subfamily within the larger OR gene family. Phylogenetic analysis places OR2A5 within class A GPCRs, sharing structural features with other olfactory receptors but having unique sequence characteristics that determine its ligand specificity .

The OR2A subfamily members show higher sequence similarity among themselves compared to other OR subfamilies. This sequence conservation suggests similar but potentially distinct ligand recognition profiles. Studies on OR sequence diversity help understand the evolution of olfactory perception across species and populations .

What expression systems are most effective for producing functional recombinant OR2A5?

Multiple expression systems have been utilized for OR2A5 production, each with distinct advantages:

Expression SystemAdvantagesChallengesYieldApplications
E. coliCost-effective, high yield, rapid growthOften produces inclusion bodies, lacks post-translational modificationsUp to 250 mg/L under optimized conditionsGood for structural studies when refolding is successful
HEK293 mammalian cellsNative-like post-translational modifications, better foldingMore expensive, lower yield, slower growth1-5 mg/L typicallyPreferred for functional studies
Tetracycline-inducible HEK293SControlled expression, stable cell lineRequires selection and maintenance~1.6 mg (monomeric form) from sixty T175 flasksSuitable for biophysical characterization
Insect cells (Sf9, Sf21)Higher yield than mammalian, proper foldingRequires baculovirus systemVariableGood compromise between yield and functionality

For functional studies requiring properly folded OR2A5, mammalian expression systems generally provide better results despite lower yields. A tetracycline-inducible HEK293S cell line has been successfully used for other olfactory receptors and could be adapted for OR2A5 . For structural studies requiring larger amounts of protein, E. coli expression followed by careful refolding protocols may be more suitable .

How can expression of soluble OR2A5 be optimized in E. coli systems?

Optimizing soluble OR2A5 expression in E. coli requires careful consideration of multiple variables. Based on studies with similar membrane proteins:

  • Strain selection: BL21(DE3), C41(DE3), or C43(DE3) strains often yield better results for membrane proteins.

  • Growth and induction conditions: An experimental design approach revealed optimal conditions for a different recombinant protein that could be adapted for OR2A5 :

    • Growth until OD600 of 0.8

    • Induction with 0.1 mM IPTG

    • Post-induction temperature of 25°C (reduced from 37°C)

    • Induction duration of 4 hours

    • Medium composition: 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

  • Fusion tags: Addition of solubility-enhancing tags such as MBP, SUMO, or Thioredoxin can significantly improve soluble expression.

  • Codon optimization: Adjusting the coding sequence to match E. coli codon usage preferences can enhance expression levels.

  • Chaperone co-expression: Co-expressing molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can assist with proper folding.

Statistical analysis of factorial design experiments is highly recommended to determine the optimal combination of variables for your specific construct .

What purification strategies yield the highest purity and activity for recombinant OR2A5?

Effective purification of OR2A5 typically involves multiple chromatography steps:

  • Initial capture: Affinity chromatography using the fusion tag (His-tag, FLAG-tag, or rho1D4 tag) attached to OR2A5. For dual-tagged constructs (e.g., FLAG-rho1D4-tagged), the first affinity step can use anti-FLAG immunoaffinity purification .

  • Intermediate purification: Size exclusion chromatography (SEC) effectively separates monomeric and oligomeric forms of the receptor. This step is crucial as OR2A5, like other GPCRs, can exist in different oligomeric states which may affect functionality .

  • Detergent selection: Critical for maintaining the native conformation of OR2A5. Commonly used detergents include:

    • n-Dodecyl-β-D-maltoside (DDM)

    • Lauryl maltose neopentyl glycol (LMNG)

    • Digitonin

  • Final polishing: Ion exchange chromatography can be used as a final step to remove remaining impurities.

Analysis by size exclusion chromatography-multi-angle light scattering (SEC-MALS) has shown the presence of both monomeric and dimeric forms of olfactory receptors. The relative proportion of these forms may affect functionality and should be carefully monitored .

What analytical methods should be used to verify the quality of purified OR2A5?

Multiple complementary methods should be used to assess OR2A5 quality:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target >90% purity)

    • Western blotting using anti-tag antibodies

    • Analytical SEC to evaluate homogeneity

  • Structural integrity:

    • Circular dichroism (CD) spectroscopy to confirm proper folding and secondary structure content

    • Intrinsic tryptophan fluorescence spectroscopy to assess tertiary structure

  • Functional verification:

    • Ligand binding assays using intrinsic tryptophan fluorescence to measure binding affinity

    • Functional activity through cAMP assays or calcium imaging in reconstituted systems

The circular dichroism analysis is particularly important for confirming that the purified receptor maintains its native α-helical structure. For olfactory receptors, proper folding correlates with a CD spectrum showing characteristic α-helical patterns .

What methods can be used to identify and validate ligands for OR2A5?

Several complementary approaches can be used for ligand identification and validation:

  • Heterologous expression systems coupled with functional assays:

    • Luciferase reporter assays using cAMP response elements

    • Calcium imaging using fluorescent calcium indicators

    • BRET/FRET-based assays to monitor receptor conformational changes

  • Direct binding assays:

    • Intrinsic tryptophan fluorescence assays (if the receptor contains appropriately positioned tryptophan residues)

    • Surface plasmon resonance (SPR) using immobilized receptor

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization

  • Computational approaches:

    • Virtual screening against OR2A5 homology models

    • Structure-based pharmacophore modeling

    • Machine learning approaches using data from the M2OR database of olfactory receptor-odorant pairs

It's crucial to validate findings across multiple assay types, as assay-dependent bias has been observed in OR-ligand interaction studies. For example, some ligands might be recognized in certain cell lines (e.g., LNCaP) but not in others (e.g., HEK293) .

How can cell-based functional assays for OR2A5 be optimized?

Optimizing cell-based functional assays for OR2A5 requires addressing several key factors:

  • Cell line selection: Different cell lines can yield varying results:

    • HEK293 cells are commonly used but may lack some components of olfactory signaling

    • HEK293T cells have higher transfection efficiency

    • LNCaP (prostate carcinoma) cells have shown success in identifying ligands for some ORs where HEK293 cells failed

  • Signal transduction pathway considerations:

    • Co-expression of Gαolf or chimeric G proteins to enhance coupling

    • Addition of RTP1S (receptor-transporting protein) and Ric-8B to improve receptor trafficking

  • Assay readout optimization:

    • For luciferase reporter assays: optimize the ratio of firefly (reporter) to Renilla (normalization control) luciferase plasmids

    • For calcium imaging: select appropriate calcium indicators based on sensitivity needs

  • Assay controls:

    • Include positive controls (receptors with known ligands)

    • Use empty vector controls to account for endogenous responses

    • Test multiple concentrations to generate dose-response curves

  • Data normalization and analysis:

    • Normalize to control for transfection efficiency, cell number, and viability

    • Apply appropriate statistical methods to determine significance

The real-time cAMP assay has been successfully used for other olfactory receptors and can be adapted for OR2A5 .

How does mutation analysis contribute to understanding OR2A5 structure-function relationships?

Mutation analysis provides critical insights into OR2A5 structure-function relationships:

  • Key functional regions identification:

    • Mutations in conserved GPCR activation mechanisms can significantly alter receptor function

    • Natural variations occurring at structurally conserved regions may impact olfactory perception

  • Ligand binding pocket mapping:

    • Systematic mutation of residues in predicted binding regions helps define the binding pocket

    • Correlating mutation effects with ligand structures reveals key interaction points

  • Population-level natural variations:

    • The Human Olfactory Receptor Mutation Database (hORMdb) contains data on natural OR variants

    • Analysis of population-specific variations can reveal evolutionary patterns and potential functional differences

  • Experimental approach:

    • Site-directed mutagenesis followed by functional assays

    • Comparison of mutation effects across related ORs to identify subfamily-specific mechanisms

    • Integration with homology modeling for structural context

Studies of natural OR variations have revealed an extraordinary diversity between individuals and populations, with significant numbers of changes occurring at structurally conserved regions that could imply phenotypic variation in olfactory perception .

How can recombinant OR2A5 be used in structural biology studies?

Structural studies of OR2A5 present significant challenges but offer immense potential:

  • Crystallography approaches:

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Lipidic cubic phase (LCP) crystallization, which has been successful for other GPCRs

    • Stabilization through ligand binding and/or thermostabilizing mutations

  • Cryo-electron microscopy (cryo-EM):

    • Particularly useful for capturing different conformational states

    • May require stabilization through antibody fragments or nanobodies

    • Preparation of homogeneous, monodisperse samples is critical

  • NMR spectroscopy:

    • Solution NMR requires stable, detergent-solubilized preparations

    • Solid-state NMR can be performed on receptor reconstituted in nanodiscs or lipid bilayers

    • Isotopic labeling (15N, 13C) is necessary for detailed structural analysis

  • Requirements for successful structural studies:

    • High-yield expression systems producing milligram quantities of pure protein

    • Verification of proper folding through circular dichroism

    • Demonstration of ligand binding activity through intrinsic tryptophan fluorescence assays

Successful structural studies of olfactory receptors would significantly advance our understanding of odor recognition mechanisms and could facilitate structure-based drug design targeting these receptors.

What bioinformatic resources are available for OR2A5 research and how can they be best utilized?

Several specialized resources enhance OR2A5 research:

  • Human Olfactory Receptor Mutation Database (hORMdb):

    • Interactive database containing natural variants of human ORs

    • Allows filtering based on topological localization, population frequencies, and substitution scores

    • Facilitates analysis of specific dbSNP entries, individual genes, or complete families

  • M2OR database:

    • Collection of olfactory receptor-odorant pairs for machine learning

    • Incorporates information about experimental procedures and assay metadata

    • Enables identification of patterns in receptor-ligand interactions

  • Sequence-based analytical approaches:

    • Identification of specificity-determining residues (SDRs) that distinguish binding profiles

    • Comparison of SDRs across species to understand evolutionary patterns

  • Utilization strategies:

    • Integrate data across multiple resources for comprehensive analysis

    • Apply machine learning approaches to predict novel ligands or functional properties

    • Combine with homology modeling and molecular dynamics simulations for structure-based insights

The M2OR database is particularly valuable because it captures assay metadata, enabling researchers to account for assay-dependent bias when interpreting OR responses .

How do OR2A5 variants affect olfactory perception across human populations?

OR2A5 variants demonstrate significant effects on olfactory perception:

  • Population diversity:

    • Extraordinary diversity of natural variations in OR genes between individuals and populations

    • Allele frequency spectrum dominated by low-frequency variants

    • Significant number of natural changes identified at GPCR functional regions

  • Functional consequences:

    • Mutations in ligand-binding cavities directly affect odorant recognition

    • Changes in conserved activation mechanisms alter signaling efficiency

    • Variants in transmembrane domains can affect receptor stability and trafficking

  • Phenotypic implications:

    • Specific variants can lead to altered perception of certain odors

    • Some variants may cause complete loss of sensitivity to particular odorants

    • The combined effect of multiple OR variants shapes individual olfactory perception profiles

  • Research applications:

    • Genotype-phenotype correlation studies to map perceptual differences

    • Development of personalized olfactory testing based on genetic profiles

    • Potential for customized fragrance development based on receptor genetics

This emerging field of "sensegenomics" investigates how genetic changes in sensory receptors shape perceptual experiences across populations, with implications for food, fragrance, and consumer product industries .

What are common challenges in recombinant OR2A5 expression and how can they be overcome?

Recombinant OR2A5 expression faces several challenges:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host

    • Solution: Use stronger promoters or inducible expression systems

    • Solution: Screen multiple construct designs with different fusion tags and linkers

  • Protein misfolding and aggregation:

    • Solution: Lower expression temperature (25-30°C) to slow folding and reduce aggregation

    • Solution: Co-express molecular chaperones to assist proper folding

    • Solution: Add stabilizing ligands during expression if known

  • Poor membrane integration:

    • Solution: Include signal sequences to direct membrane insertion

    • Solution: Co-express accessory proteins like RTP1S that facilitate OR trafficking

    • Solution: Use specialized membrane protein expression hosts

  • Cytotoxicity:

    • Solution: Use tightly controlled inducible systems to prevent leaky expression

    • Solution: Optimize induction time and concentration to balance yield and toxicity

    • Solution: Consider cell-free expression systems for highly toxic constructs

  • Post-translational modifications:

    • Solution: Choose expression systems capable of mammalian-like glycosylation if required

    • Solution: Modify constructs to remove non-essential glycosylation sites if using bacterial systems

Experimental design approaches employing factorial design can systematically optimize multiple variables simultaneously, significantly improving expression outcomes .

How can the stability of purified OR2A5 be improved for long-term storage and functional studies?

Improving OR2A5 stability requires multiple strategies:

  • Buffer optimization:

    • Screen different pH conditions (typically pH 7.0-8.0)

    • Test various salt concentrations (150-300 mM NaCl common for GPCRs)

    • Include glycerol (20-50%) as a cryoprotectant for frozen storage

  • Detergent selection and optimization:

    • Test detergent panels to identify optimal surfactant

    • Consider newer detergents designed for GPCR stability (MNG nanodiscs, GNG)

    • Maintain detergent above critical micelle concentration (CMC)

  • Ligand stabilization:

    • Add known ligands or antagonists during purification and storage

    • Thermostabilizing compounds can enhance protein stability even without being ligands

  • Storage conditions:

    • Aliquot to avoid freeze-thaw cycles

    • Store at -80°C for long-term storage

    • For working stocks, store at 4°C for up to one week

  • Alternative formulations:

    • Reconstitution into nanodiscs or liposomes

    • Lipid addition to detergent micelles

    • Polymer-bound systems like SMALPs (styrene-maleic acid lipid particles)

The stability can be monitored over time using techniques such as circular dichroism, intrinsic fluorescence, and functional binding assays to establish optimal conditions and storage duration limits.

What controls and validation steps are essential for OR2A5 functional studies?

Rigorous controls are critical for reliable OR2A5 functional characterization:

  • Expression verification controls:

    • Western blot analysis to confirm protein expression

    • Immunofluorescence or flow cytometry to verify surface expression before functional assays

    • Quantification of expression levels for normalization

  • Functional assay controls:

    • Positive control: well-characterized OR with known ligand

    • Negative control: non-transfected cells and empty vector transfection

    • Vehicle control: solvent used to dissolve test compounds

  • Dose-response validation:

    • Test multiple concentrations to establish full dose-response curves

    • Calculate EC50 values to compare potency across ligands

    • Test for receptor saturation at high ligand concentrations

  • Cross-validation across assay types:

    • Confirm findings using multiple functional readouts (cAMP, calcium, etc.)

    • Validate with direct binding assays where possible

    • Test in multiple cell types to account for assay-dependent bias

  • Data analysis and reporting standards:

    • Apply appropriate statistical tests for significance

    • Report complete methods including cell lines, assay conditions, and analysis parameters

    • Include raw data and replicates for reproducibility assessment

The integration of appropriate controls and validation steps is essential to overcome the challenges of assay-dependent bias that has been reported in OR research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.