Recombinant Human Olfactory receptor 2A7 (OR2A7)

Shipped with Ice Packs
In Stock

Description

Expression and Functional Roles

OR2A7 is ectopically expressed in non-olfactory tissues, including:

  • Skin: Mediates keratinocyte migration and wound healing via CHS-induced MAPK/AKT phosphorylation .

  • Airway Epithelium: Potential roles in chemosensation or immune modulation .

  • Testis: Co-expressed with non-coding RNA loc728377, though functional implications remain unclear .

Dermatological Applications

  • Keratinocyte Proliferation: CHS-activated OR2A7 increases HaCaT cell migration and wound closure rates by 40–60% in vitro .

  • Inflammatory Modulation: Upregulates IL-2 and IL-6 in keratinocytes, suggesting a role in atopic dermatitis (AD) pathophysiology .

Challenges in Study

  • Low Native Expression: OR2A7 mRNA levels are low in most tissues (FPKM <1 in RNA-Seq datasets), necessitating recombinant overexpression for functional studies .

  • Ligand Promiscuity: Binds multiple odorants with varying affinities, complicating in vivo role elucidation .

Future Directions

Current research focuses on:

  • Therapeutic Targeting: OR2A7’s role in skin repair and inflammation could inform AD or wound-healing therapies .

  • Structural Resolution: Cryo-EM studies to resolve ligand-binding mechanisms and metal ion interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2A7; Olfactory receptor 2A7; Olfactory receptor OR7-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2A7
Target Protein Sequence
MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTC FSHLCVIGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Proliferation tests, ELISA, and kinase array studies suggest that OR2A4/7 and CHS play significant roles in the proliferation of HaCaT cells and keratinocytes. PMID: 27315375
Database Links

HGNC: 8234

KEGG: hsa:107987545

STRING: 9606.ENSP00000420502

UniGene: Hs.658609

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2A7 and what is its classification within the olfactory receptor family?

OR2A7 is a G protein-coupled receptor (GPCR) belonging to the olfactory receptor family, encoded by the OR2A7 gene in humans. It shares approximately 99% sequence homology with OR2A4 . As a member of the Class A GPCR superfamily, OR2A7 features the characteristic seven-transmembrane domain structure. Interestingly, parts of its open reading frame (ORF) overlap with an exon of the rho guanine nucleotide exchange factor 34 pseudogene (ARHGEF34P) . Despite being primarily associated with olfactory sensory neurons (OSNs) in the nasal epithelium, OR2A7 exhibits ectopic expression in various non-olfactory tissues, suggesting broader physiological roles beyond olfaction.

Detection of OR2A7 can be challenging due to its typically low expression levels. Recommended approaches include:

Transcript detection:

  • Quantitative RT-PCR with OR2A7-specific primers

  • RNA-seq analysis with careful mapping parameters to distinguish from the highly homologous OR2A4

  • In situ hybridization using probes designed to differentiate from similar OR transcripts

Protein detection:

  • Western blotting using antibodies against OR2A7 or epitope tags (e.g., rho1D4 tag)

  • Immunofluorescence microscopy with specific antibodies

  • Flow cytometry for quantitative analysis of surface expression

When examining OR2A7 in tissue samples, RNA-seq data analysis should use a threshold of median transcripts per million (TPM) values of ≥1 for reliable detection . For protein analysis, immunohistochemistry results should be validated with appropriate negative controls due to potential cross-reactivity with OR2A4.

What is currently known about the ligand specificity of OR2A7 and how can it be experimentally determined?

OR2A7 has been deorphanized through systematic screening approaches. Key findings include:

In yeast-based screening systems, OR2A7 responded to 5 different chemical hits from a 57-member chemical panel . Among the validated ligands, lilial (also known as p-tert-butyl-α-methylhydrocinnamaldehyde) activates OR2A7 with an EC50 of approximately 110 μM .

Structure-activity relationship studies indicate that both the tert-butyl group and the aldehyde moiety are necessary for OR2A7 activation, as demonstrated by the lack of response to tert-butylbenzene which lacks the aldehyde side chain .

For experimental determination of OR2A7 ligands, researchers should consider:

  • High-throughput screening methodologies:

    • Luciferase reporter assays in Hana3A cell lines with RTP1/2 chaperones

    • Calcium imaging using fluorescent indicators like Fura-2AM

    • HTRF (homogeneous time-resolved fluorescence) cAMP assays

  • Dose-response characterization:

    • Test compounds across concentration ranges from nanomolar to high micromolar

    • Calculate EC50 values to determine relative potency

    • Validate with multiple biological replicates

  • Structure-activity relationship analysis:

    • Test structural analogs to identify key molecular determinants

    • Compare responses between OR2A7 and the closely related OR2A4

When interpreting results, researchers should note that ligand specificity may differ depending on the G protein coupling partner (Gαolf vs. GPA1) , and assay-dependent bias has been observed in OR deorphanization studies .

Recent studies have revealed significant associations between OR2A7 expression and cancer pathology:

In clear cell renal cell carcinoma (KIRC), OR2A7 shows altered expression patterns compared to normal kidney tissue . Notably, there are sex-based differences in OR2A7 expression in KIRC, with females exhibiting significantly higher expression levels .

OR2A7 has been implicated in cellular processes relevant to cancer progression:

  • Influences cytokinesis and cell division

  • Increases cell proliferation rates

  • Modulates IL-1 secretion, suggesting a role in inflammatory processes

For researchers investigating OR2A7 in cancer contexts, consider these methodological approaches:

  • Expression analysis in clinical samples:

    • RNA-seq analysis with appropriate normalization

    • Tissue microarray immunohistochemistry

    • Single-cell RNA-seq to identify expressing cell populations

  • Functional characterization:

    • siRNA-mediated knockdown to assess phenotypic consequences

    • Overexpression studies to evaluate oncogenic potential

    • Cell proliferation and migration assays

    • Cytokine secretion measurements

  • Sex-based expression differences:

    • Stratify analyses by sex

    • Investigate potential hormonal regulation of OR2A7

    • Consider implications for personalized medicine approaches

When interpreting cancer-related expression data, researchers should be aware that sequence similarity between OR2A7 and OR2A4 (99% homology) may complicate specific attribution of effects .

What approaches can be used for purification of recombinant OR2A7 for structural studies?

Purification of recombinant OR2A7 for structural studies represents a significant challenge that can be addressed using methods adapted from other olfactory receptor purification protocols:

Based on successful approaches used for hOR17-4 (another human olfactory receptor), the following strategy can be applied to OR2A7 :

  • Expression system optimization:

    • Use tetracycline-inducible mammalian cell lines (e.g., HEK293S) for controlled expression

    • Include sodium butyrate (5 mM) during induction to enhance expression levels

    • Codon-optimize the OR2A7 sequence for improved translation

    • Append affinity tags, such as the 9-residue bovine rhodopsin tag (rho1D4), for detection and purification

  • Solubilization and extraction:

    • Screen multiple detergents; fos-choline-14 (N-tetradecylphosphocholine) has shown efficacy for olfactory receptors

    • Optimize detergent concentration and solubilization time

  • Two-step purification protocol:

    • Immunoaffinity chromatography using anti-tag antibodies (e.g., rho1D4 antibody linked to sepharose beads)

    • Size exclusion chromatography to separate monomeric from oligomeric forms

    • Elution using specific peptides (e.g., TETSQVAPA nonapeptide for rho1D4 tag)

  • Quality assessment:

    • SDS-PAGE and western blotting to confirm purity and identity

    • Mass spectrometry for precise molecular weight determination

    • Circular dichroism to verify secondary structure integrity

Expected yields from optimized mammalian expression systems are approximately 2-3 μg purified receptor per 150 mm tissue culture plate . For structural studies, researchers should be aware that olfactory receptors often show heterogeneity in glycosylation, appearing as multiple bands on SDS-PAGE (typically 30-32 kDa for the monomeric form) .

How can adaptive changes in OR2A7 expression be studied in response to environmental stimuli?

Olfactory receptors, including OR2A7, demonstrate adaptive changes in expression in response to environmental odor statistics. To study these adaptations:

  • Experimental design considerations:

    • Design controlled odor exposure experiments with defined chemical compositions

    • Determine baseline OR2A7 expression before exposure

    • Measure changes after short-term (hours to days) and long-term (weeks) exposure

    • Consider mathematical models of optimal receptor distribution

  • Quantitative measurement approaches:

    • RNA-seq to measure transcript abundance changes

    • Single-molecule FISH to visualize expression in tissue context

    • Flow cytometry for quantifying receptor-expressing cell populations

  • Data analysis frameworks:

    • Apply information-theoretic approaches to model efficient coding principles

    • Calculate response covariance matrices from experimental data

    • Use predictive models that incorporate environment covariance matrices

The adaptation of OR2A7 abundance can be understood through mathematical models of efficient coding, where receptor numbers adapt to maximize information transfer about odor statistics . This adaptation process involves temporal averaging of co-occurring activations via lateral connections and feedback mechanisms from the olfactory bulb to the epithelium .

When designing experiments to study OR2A7 adaptation, researchers should be aware that convergence times to new optimal expression levels can vary significantly, with some receptor types taking longer than others to reach steady state after environmental changes .

What are the practical considerations for developing OR2A7 as a diagnostic biomarker?

Based on recent studies showing altered expression of olfactory receptors in disease states, OR2A7 holds potential as a diagnostic biomarker:

  • Validation requirements:

    • Establish robust reference ranges in healthy populations

    • Determine sensitivity and specificity in disease detection

    • Validate across diverse demographic groups, accounting for sex-based differences

    • Compare performance against existing biomarkers

  • Technical implementation approaches:

    • Develop qRT-PCR assays with high specificity for OR2A7 vs. OR2A4

    • Create antibody-based detection methods (ELISA, immunohistochemistry)

    • Design multiplex panels that include other relevant olfactory receptors

  • Clinical considerations:

    • For renal cell carcinoma, consider combining OR2A7 with OR2A4, OR51E1, and OR7E14P for improved diagnostic accuracy (combined AUC of 0.972)

    • Address sex-based differences in expression thresholds

    • Evaluate utility for monitoring treatment response

Researchers should note that in KIRC, several olfactory receptors including OR2A7 show significant expression changes with diagnostic potential. The combination of multiple OR genes improves diagnostic performance beyond individual markers .

Methodological Considerations

The 99% sequence homology between OR2A7 and OR2A4 presents significant challenges for specific detection and functional characterization. Recommended approaches include:

  • Nucleic acid-based discrimination:

    • Design PCR primers or probes targeting the few nucleotide differences

    • Use high-fidelity DNA polymerases and optimized annealing temperatures

    • Employ digital PCR for absolute quantification

    • Sequence verification of cloned constructs

  • Protein-level discrimination:

    • Generate antibodies against peptide regions containing amino acid differences

    • Validate antibody specificity using recombinant proteins

    • Consider epitope tagging strategies with different tags for each receptor

  • Functional differentiation:

    • Compare pharmacological profiles of both receptors

    • Use selective ligands if available

    • Develop knockout or siRNA strategies targeting specific untranslated regions

When interpreting published studies, researchers should carefully assess whether OR2A7 and OR2A4 were definitively distinguished, as some earlier literature may have attributed functions without sufficient discrimination between these highly similar receptors .

What databases and resources are available for OR2A7 research?

Several specialized databases and resources can assist researchers studying OR2A7:

  • M2OR database:

    • Contains OR-odorant interaction data

    • Includes information on bioassay methods, stereochemistry, and concentrations

    • Documents both responsive and non-responsive OR-molecule pairs

    • Provides details on experimental procedures used for screening

  • General resources:

    • HORDE (Human Olfactory Receptor Data Exploratorium)

    • ORDB (Olfactory Receptor Database)

    • The Human Protein Atlas for tissue expression data

    • The Cancer Genome Atlas (TCGA) for cancer-related expression patterns

  • Predictive tools:

When using these resources, researchers should consider that olfactory receptor nomenclature has evolved, and OR2A7 may be referenced under alternative identifiers in older literature. Additionally, M2OR includes crucial information like experimental conditions and molecule concentrations that may be absent from other databases .

What are the key considerations for designing siRNA-mediated knockdown experiments for OR2A7?

When designing siRNA experiments to study OR2A7 function:

  • siRNA design challenges:

    • Target unique regions that differ from OR2A4 (99% homology)

    • Design multiple siRNAs targeting different regions

    • Include negative controls (non-targeting siRNA) and positive controls

    • Validate knockdown specificity using qRT-PCR with discriminating primers

  • Experimental design:

    • Determine optimal transfection conditions for your cell type

    • Establish time course of knockdown effect (typically 24-72 hours)

    • Use appropriate concentration ranges to minimize off-target effects

    • Consider rescue experiments with siRNA-resistant OR2A7 constructs

  • Functional readouts:

    • Cell proliferation assays (OR2A7 influences cell proliferation)

    • Cytokinesis analysis

    • IL-1 secretion measurements

    • Ca²⁺ signaling in response to known ligands

    • AKT and CHK-2 pathway activation

Researchers should be aware that siRNA experiments have successfully demonstrated OR2A7's influence on cytokinesis, cell proliferation, and IL-1 secretion in previous studies , providing established protocols that can be adapted for new research questions.

What are the most promising approaches for investigating OR2A7's non-olfactory functions?

OR2A7's expression outside the olfactory epithelium suggests important non-olfactory functions that warrant further investigation:

  • Tissue-specific functional characterization:

    • Generate tissue-specific conditional knockout models

    • Perform single-cell transcriptomics to identify specific cell types expressing OR2A7

    • Investigate pathways unique to non-olfactory contexts

  • Identification of endogenous ligands:

    • Screen tissue metabolites as potential natural ligands

    • Investigate autocrine/paracrine signaling molecules

    • Develop untargeted metabolomic approaches to identify candidate compounds

  • Integration with broader cellular networks:

    • Map protein-protein interactions using proximity labeling approaches

    • Identify downstream transcriptional changes using RNA-seq

    • Investigate cross-talk with other signaling pathways

The role of OR2A7 in cell proliferation and cytokine secretion suggests it may function in tissue homeostasis and immune regulation . Researchers should consider that while synthetic ligands like lilial can activate OR2A7, the physiologically relevant endogenous activating substances in non-olfactory tissues remain to be identified .

How might the overlapping genomic architecture of OR2A7 with ARHGEF34P pseudogene affect its expression and function?

The overlap between the OR2A7 open reading frame and an exon of the rho guanine nucleotide exchange factor 34 pseudogene (ARHGEF34P) presents intriguing research questions:

  • Transcriptional regulation investigation:

    • Analyze promoter regions and transcription start sites

    • Perform chromatin immunoprecipitation to identify regulatory factors

    • Use reporter assays to delineate functional regulatory elements

  • Post-transcriptional mechanisms:

    • Investigate alternative splicing patterns

    • Examine mRNA stability and half-life

    • Explore potential RNA-RNA interactions affecting expression

  • Evolutionary significance:

    • Compare genomic architecture across species

    • Analyze selection pressures on overlapping regions

    • Investigate potential functional constraints on sequence evolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.