Recombinant Human Olfactory receptor 2AG1 (OR2AG1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Ligand Interactions

OR2AG1 is implicated in both olfactory and non-olfactory pathways:

Olfactory Function

  • Primary Ligand: Amyl butyrate, a fruity/banana-like odorant, activates OR2AG1 .

  • Pyrazine Response: Structural studies show OR2AG1 responds to 2-isopropyl-3-methoxypyrazine (green/earthy notes) .

Non-Olfactory Roles

  • Airway Smooth Muscle Regulation:

    • Inhibits histamine-induced contraction via cAMP signaling .

    • Modulates IL-8 and GM-CSF cytokine secretion when activated .

  • Signaling Pathway: Agonist binding triggers Ca²⁺ influx and cAMP-dependent cascades involving adenylyl cyclase III (ACIII) and cyclic nucleotide-gated (CNG) channels .

Research Applications and Findings

Recombinant OR2AG1 has enabled breakthroughs in multiple fields:

Key Studies

Study FocusFindingsSource
Structural BiologyPurified OR2AG1 retains folded conformation in detergent micelles .
Biosensor DevelopmentIntegrated into graphene-based devices for amyl butyrate detection (sensitivity: 0.5 pM) .
Therapeutic PotentialProposed target for asthma/COPD due to bronchodilatory effects .
Ligand SpecificityRequires methoxy and isopropyl groups on pyrazines for activation .

Challenges and Technical Considerations

  • Expression Difficulties: Requires chaperones (e.g., Hsc70t) for proper folding in heterologous systems .

  • Dimerization: Exists as both monomeric and dimeric forms, complicating structural studies .

  • Ligand Discrepancies: Amyl butyrate activation conflicts with pyrazine-specific responses in some assays .

Future Directions

  • Crystallography: High-resolution structures could clarify ligand-binding mechanisms.

  • Drug Discovery: Screen for small molecules targeting OR2AG1 in airway diseases.

  • Multi-OR Networks: Study interactions with other receptors in odor perception .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
OR2AG1; OR2AG3; Olfactory receptor 2AG1; HT3; Olfactory receptor 2AG3; Olfactory receptor OR11-79
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2AG1
Target Protein Sequence
MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYMLPAHSTL
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Hsc70t facilitates the expression of OR2AG1 in heterologous cell systems, aiding in the characterization of this "orphan" human olfactory receptor. PMID: 16565291
  2. OR2AG1 binds beta-arrestin2 with high affinity and undergoes internalization via a clathrin-dependent mechanism. PMID: 17005854
Database Links

HGNC: 15142

KEGG: hsa:144125

STRING: 9606.ENSP00000307447

UniGene: Hs.553608

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are used for recombinant OR2AG1 production?

The most commonly documented expression system for recombinant OR2AG1 production is Escherichia coli (E. coli). When expressing OR2AG1 in this system, researchers typically fuse the protein with an N-terminal histidine tag (His-tag) to facilitate purification through affinity chromatography .

The standard expression protocol involves:

  • Cloning the OR2AG1 gene sequence into an appropriate expression vector

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using His-tag affinity chromatography

  • Further purification steps as needed (gel filtration, ion exchange)

  • Validation of protein identity and purity through SDS-PAGE and/or Western blot

The purified protein is typically obtained as a lyophilized powder that requires careful reconstitution before experimental use. Researchers should reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, often with 5-50% glycerol added for long-term storage stability .

What are the optimal storage conditions for recombinant OR2AG1?

For optimal stability and functionality of recombinant OR2AG1, proper storage conditions are critical. Based on established protocols, the following storage guidelines should be implemented:

  • Store lyophilized OR2AG1 powder at -20°C to -80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for short-term use (up to one week)

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% being standard) and store aliquots at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity and stability

  • Use Tris/PBS-based buffer containing 6% trehalose at pH 8.0 as a storage buffer

When preparing for experiments, briefly centrifuge the vial prior to opening to ensure all content is at the bottom. Aliquoting reconstituted protein is strongly recommended to minimize freeze-thaw cycles even for stocks stored at -80°C.

How can cell surface expression of OR2AG1 be improved in heterologous systems?

Olfactory receptors, including OR2AG1, are notoriously difficult to express functionally on the cell surface in heterologous systems. This challenge has historically limited our understanding of their response patterns to odorants. Recent research has demonstrated that targeting transcription efficiency can significantly improve both surface expression and functional activity of human olfactory receptors .

The TAR-Tat system represents a breakthrough approach for enhancing OR2AG1 expression. This system utilizes a positive feedback mechanism to amplify transcription, resulting in:

  • Increased mRNA levels of the target olfactory receptor

  • Enhanced protein production

  • Improved trafficking to the cell membrane

  • Greater functional response to odorants

Implementation of this system involves:

  • Incorporating the TAR element into the expression vector

  • Co-expressing the Tat protein, which binds to TAR and enhances transcription

  • Optimizing the ratio of receptor and accessory protein expression

This approach has been demonstrated to induce robust expression of several human olfactory receptors, and the same principles can be applied to OR2AG1 expression systems .

What experimental designs can effectively measure OR2AG1 activation in response to potential ligands?

Measuring OR2AG1 activation requires specialized experimental designs that can detect receptor-ligand interactions and subsequent signaling cascades. Several methodological approaches have proven effective:

  • Calcium imaging assays:

    • Transfect cells with OR2AG1 and Gα15/16 (promiscuous G proteins)

    • Load cells with calcium-sensitive fluorescent dyes (Fluo-4, Fura-2)

    • Measure changes in intracellular calcium upon ligand application

    • Record using fluorescence microscopy or plate readers

  • cAMP accumulation assays:

    • Use FRET-based sensors or luminescence-based detection systems

    • Measure changes in cAMP levels upon receptor activation

    • Employ CRE-luciferase reporter systems for high-throughput screening

  • Surface plasmon resonance (SPR):

    • Immobilize purified OR2AG1 on sensor chips

    • Flow potential ligands over the surface

    • Measure direct binding events in real-time

  • Electrophysiological recordings:

    • Patch-clamp techniques to measure changes in membrane potential

    • Requires specialized equipment and expertise

The enhanced transcription efficiency approaches discussed earlier (TAR-Tat system) should be incorporated into these experimental designs to ensure sufficient receptor expression for reliable detection .

How should data from OR2AG1 functional studies be organized and analyzed?

Proper data organization and analysis are crucial for interpreting OR2AG1 functional studies. A standardized approach includes:

Table 1: Example Format for Dose-Response Data Organization

Ligand Concentration (μM)Normalized Response (% of max)Standard DeviationNumber of Replicates
0 (control)0±0.55
0.112.3±2.15
135.7±4.35
1068.4±5.25
10094.2±3.75
1000100±2.95

For data analysis, follow these steps:

  • Normalize raw data to internal controls

  • Perform dose-response curve fitting using nonlinear regression

  • Calculate EC50/IC50 values with 95% confidence intervals

  • Apply appropriate statistical tests to determine significance

  • Create visual representations that clearly illustrate response patterns

  • Compare results across different experimental conditions or receptor variants2

It's also essential to record all experimental conditions meticulously, including cell type, transfection efficiency, protein expression levels, and assay conditions, as these factors can significantly impact the results.

How does the TAR-Tat transcription enhancement system specifically improve OR2AG1 functional studies?

The TAR-Tat system represents a sophisticated approach to overcoming the inherent difficulties in expressing functional olfactory receptors. For OR2AG1 specifically, the system works through a multi-faceted mechanism:

  • Enhanced transcriptional feedback loop:

    • The TAR (Trans-Activation Response) element is incorporated into the expression vector containing OR2AG1

    • The Tat protein binds to the TAR element, recruiting transcriptional machinery

    • This creates a positive feedback loop that dramatically increases mRNA production

    • Higher mRNA levels compensate for inefficient translation and trafficking

  • Quantifiable improvements in OR2AG1 expression:

    • Studies with similar olfactory receptors show up to 5-fold increases in surface expression

    • Functional response sensitivity can improve by 2-10 fold depending on the ligand

    • The signal-to-noise ratio in functional assays is significantly enhanced

    • Lower concentrations of odorants become detectable than with conventional expression systems

  • Impact on experimental outcomes:

    • Previous false negatives in ligand screening may become positives

    • Dose-response curves shift, providing more accurate EC50 values

    • Lower baseline activity enables detection of inverse agonists (as demonstrated with n-hexanal for some olfactory receptors)

The TAR-Tat system has proven particularly valuable for identifying n-hexanal as both an agonist and inverse agonist for different olfactory receptors, suggesting that this approach could similarly reveal previously undetected ligands for OR2AG1.

What are the most effective strategies for resolving and analyzing OR2AG1 structure-function relationships?

Understanding OR2AG1 structure-function relationships requires sophisticated experimental approaches that integrate multiple techniques:

  • Computational modeling and molecular dynamics:

    • Homology modeling based on solved GPCR structures

    • Molecular docking studies to predict ligand binding sites

    • Molecular dynamics simulations to analyze conformational changes

    • Identification of key residues potentially involved in ligand binding

  • Site-directed mutagenesis:

    • Systematic mutation of predicted binding pocket residues

    • Creation of chimeric receptors to identify functional domains

    • Point mutations to identify critical amino acids for signaling

  • Advanced structural biology techniques:

    • Cryo-electron microscopy to resolve protein structure

    • X-ray crystallography (challenging for membrane proteins)

    • NMR studies of specific domains or the full receptor

    • Cross-linking studies to identify binding interfaces

  • Functional validation:

    • Correlate structural predictions with functional outcomes

    • Design experiments that test specific structural hypotheses

    • Use the enhanced expression systems (TAR-Tat) to ensure sufficient protein levels

These approaches should be integrated into a comprehensive research strategy that iteratively refines structural models based on functional data and vice versa. The amino acid sequence provided in the basic section can serve as the foundation for computational modeling efforts .

How can transcriptomics and systems biology approaches enhance our understanding of OR2AG1 in the broader olfactory system?

Investigating OR2AG1 within the broader context of the olfactory system requires integrative approaches that span multiple biological scales:

  • Single-cell transcriptomics:

    • Characterize expression patterns of OR2AG1 in specific olfactory sensory neuron populations

    • Identify co-expressed factors that may influence receptor function

    • Map developmental trajectories of OR2AG1-expressing neurons

    • Compare expression levels across different individuals or conditions

  • Systems-level analysis:

    • Map the neural circuits connected to OR2AG1-expressing neurons

    • Trace axonal projections to specific glomeruli in the olfactory bulb

    • Analyze network properties of OR2AG1-associated circuits

    • Develop mathematical models of signal integration

  • Comparative genomics and evolution:

    • Compare OR2AG1 sequence and function across species

    • Analyze selection pressures on different domains of the receptor

    • Identify conserved regulatory elements controlling expression

  • Integration with behavioral studies:

    • Connect OR2AG1 activation to specific olfactory perceptions

    • Develop assays that quantify behavioral responses to OR2AG1 ligands

    • Use genetic approaches to manipulate OR2AG1 function in vivo

These multi-level approaches can reveal how OR2AG1 functions not just as an isolated molecular detector but as part of an integrated sensory system. This holistic understanding has implications for both basic olfactory science and potential biomedical applications .

How can researchers overcome common challenges in OR2AG1 protein expression and purification?

Expressing and purifying functional OR2AG1 presents several challenges that can be addressed through specialized protocols:

  • Addressing poor expression yields:

    • Optimize codon usage for the expression system

    • Use stronger promoters or inducible expression systems

    • Implement the TAR-Tat system to enhance transcription efficiency

    • Test different E. coli strains specialized for membrane protein expression

    • Consider alternative expression systems (insect cells, mammalian cells)

  • Improving protein solubility and stability:

    • Express fusion proteins with solubility-enhancing tags (MBP, SUMO)

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Include stabilizing agents like trehalose (6%) in storage buffers

    • Test different detergents for membrane protein extraction

  • Enhancing purification outcomes:

    • Implement two-step purification strategies (affinity + size exclusion)

    • Use specialized resins for His-tagged membrane proteins

    • Optimize imidazole concentration gradients during elution

    • Carefully monitor and minimize protein aggregation

  • Quality control measures:

    • Verify protein identity by Western blot and mass spectrometry

    • Assess protein folding using circular dichroism spectroscopy

    • Confirm functionality through ligand binding assays

    • Monitor batch-to-batch consistency with standardized assays

Implementing these strategies can significantly improve the yield and quality of purified OR2AG1, enabling more reliable downstream functional and structural studies.

What are the best approaches for validating OR2AG1 ligand interactions and distinguishing true positives from artifacts?

Validating true OR2AG1-ligand interactions requires rigorous controls and complementary approaches:

  • Comprehensive control experiments:

    • Use untransfected cells as negative controls

    • Include known functional GPCRs as positive controls

    • Test empty vectors expressing only accessory proteins

    • Run parallel assays with closely related olfactory receptors

  • Dose-response validation:

    • Generate complete dose-response curves (typically 6-8 concentrations)

    • Calculate EC50/IC50 values with confidence intervals

    • Test for competitive binding with known ligands

    • Evaluate response kinetics with rapid application systems

  • Orthogonal validation approaches:

    • Confirm binding results with multiple independent techniques

    • Combine functional (calcium, cAMP) with direct binding assays

    • Use biophysical methods (SPR, isothermal titration calorimetry)

    • Validate key findings in different cell types or expression systems

  • Structure-activity relationship analysis:

    • Test structural analogs of potential ligands

    • Create a pharmacophore model based on active compounds

    • Synthesize derivatives to test specific binding hypotheses

    • Use computational modeling to predict and test binding modes

  • Statistical rigor:

    • Perform experiments with sufficient biological and technical replicates

    • Apply appropriate statistical tests with multiple comparison corrections

    • Establish clear criteria for distinguishing significant from non-significant responses

    • Consider blinded experimental designs for ligand testing

Implementing these validation strategies minimizes false positives and increases confidence in identified OR2AG1 ligands.

How might advances in structural biology and protein engineering expand our understanding of OR2AG1?

Emerging technologies in structural biology and protein engineering offer promising avenues for advancing OR2AG1 research:

  • Cutting-edge structural approaches:

    • Application of AlphaFold and other AI-based structural prediction tools

    • Integration of hydrogen-deuterium exchange mass spectrometry

    • Development of lipid nanodisc systems for native-like membrane environments

    • Time-resolved structural studies to capture activation intermediates

  • Receptor engineering strategies:

    • Design of stabilized OR2AG1 variants through consensus mutations

    • Creation of biosensors by fusing OR2AG1 with fluorescent proteins

    • Development of chimeric receptors with enhanced trafficking properties

    • Implementation of optogenetic controls for temporal precision

  • High-throughput screening technologies:

    • Development of cell-free expression systems specific for olfactory receptors

    • Miniaturized and parallelized functional assays

    • Microfluidic platforms for single-cell analysis of receptor function

    • Application of DNA-encoded chemical libraries for ligand discovery

  • Translational applications:

    • Development of OR2AG1-based biosensors for environmental monitoring

    • Exploration of potential roles in disease diagnostics

    • Investigation of therapeutic applications targeting olfactory signaling

    • Creation of bioelectronic noses incorporating multiple olfactory receptors

These advanced approaches promise to overcome current limitations in OR2AG1 research and expand its applications in both basic science and biotechnology.

What are the implications of recent discoveries about transcriptional enhancement for the broader field of GPCR research?

The insights gained from transcriptional enhancement of olfactory receptors have significant implications for the broader GPCR research field:

  • Paradigm shift in expression strategies:

    • Traditional focus on protein trafficking may be complemented by transcriptional approaches

    • Combined enhancement of transcription, translation, and trafficking could maximize GPCR expression

    • Systematic comparison of different enhancement strategies across GPCR families

    • Development of customized expression systems for difficult-to-express GPCRs

  • Impact on drug discovery:

    • Enhanced expression enables screening of previously intractable GPCR targets

    • Improved signal-to-noise ratios increase hit rates in high-throughput screens

    • Lower expression barriers facilitate structure determination efforts

    • More reliable pharmacological characterization of receptor-ligand interactions

  • Mechanistic insights:

    • Understanding how increased mRNA levels overcome post-translational bottlenecks

    • Identifying rate-limiting steps in GPCR expression pathways

    • Exploring relationships between transcription rates and protein quality control

    • Developing predictive models for GPCR expression optimization

  • Technological applications:

    • Development of universal expression enhancement cassettes for GPCR research

    • Creation of standardized cell lines with optimized transcriptional machinery

    • Implementation in industrial protein production pipelines

    • Application to other difficult-to-express membrane protein families

The TAR-Tat system and other transcriptional enhancement approaches may fundamentally change how researchers approach the expression of challenging membrane proteins, potentially accelerating discovery across multiple fields.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.