Recombinant Human Olfactory receptor 2AG2 (OR2AG2)

Shipped with Ice Packs
In Stock

Description

Olfactory Signaling

OR2AG2 detects odorant molecules, activating downstream cAMP-mediated signaling pathways in olfactory sensory neurons . Ligand binding triggers conformational changes, enabling G-protein coupling and neuronal activation. Studies using recombinant OR2AG2 in HEK293 cells demonstrated:

  • Ligand Specificity: Binds to odorants like dihydrojasmone with micromolar affinity (KdμMK_d \approx \mu M range) .

  • Concentration Dependence: Odorant responses are dose-dependent, with EC₅₀ values critical for receptor activation .

Non-Olfactory Roles

  • Asthma Pathophysiology: Reduced OR2AG2 RNA levels in asthmatic lung tissues correlate with impaired mucociliary clearance and airway hyperresponsiveness .

  • IL-13 Modulation: Cytokine IL-13 suppresses OR2AG2 expression, linking olfactory receptors to inflammatory pathways .

Recombinant Production and Purification

Recombinant OR2AG2 is produced using systems such as:

  • HEK293 Cells: Stable tetracycline-inducible systems yield functional, membrane-localized receptors .

  • E. coli: Cost-effective for large-scale production, though lacking post-translational modifications .

Purification Workflow ( ):

  1. Detergent Solubilization: Extracts receptors from cell membranes.

  2. Immunoaffinity Chromatography: Anti-FLAG or His-tag columns isolate tagged receptors.

  3. Gel Filtration: Separates monomeric (~1.6 mg) and dimeric (~1.1 mg) forms .

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery estimates, please consult your local distributors.
All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2AG2; OR2AG2P; Olfactory receptor 2AG2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR2AG2
Target Protein Sequence
MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAY DRYVAICHPLKYMTLMSPRVCWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCE IPPLLKLACADTSRYELIIYVTGVTFLLLPISAIVASYTLVLFTVLRMPSNEGRKKALVT CSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYILLAHSTL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15143

KEGG: hsa:338755

STRING: 9606.ENSP00000342697

UniGene: Hs.534614

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2AG2 and what is its role in human physiology?

OR2AG2 (Olfactory Receptor Family 2 Subfamily AG Member 2) is a G-protein coupled receptor (GPCR) primarily expressed in olfactory sensory neurons but also found in non-olfactory tissues including the lungs. Like other olfactory receptors, OR2AG2 features seven transmembrane domains characteristic of GPCRs. Its primary function involves detecting odorant molecules and initiating signaling cascades that contribute to olfactory sensation. Recent research has revealed that OR2AG2 may play important roles in respiratory function, particularly in mucociliary clearance and airway regulation, potentially impacting respiratory conditions such as asthma . The receptor is activated by specific odorant molecules, triggering downstream signaling that influences cellular responses in both olfactory and non-olfactory tissues.

What experimental approaches are most effective for studying OR2AG2 gene expression?

For studying OR2AG2 gene expression, researchers should employ multiple complementary techniques. Quantitative real-time PCR has proven effective for measuring OR2AG2 mRNA levels in lung tissues, as demonstrated in studies comparing expression between asthmatic and non-asthmatic subjects . RNA sequencing provides a broader view of expression patterns and can identify co-regulated genes. For cell-specific expression analysis, single-cell RNA sequencing would be valuable to identify specific cell populations expressing OR2AG2 in both olfactory and non-olfactory tissues. In situ hybridization can localize OR2AG2 expression within tissue contexts. Reporter gene assays using the OR2AG2 promoter can help identify regulatory elements and transcription factors. When studying expression changes in disease states or in response to stimuli, appropriate controls and normalization strategies are crucial, as OR2AG2 expression has been shown to decrease in asthma and in response to IL-13 treatment .

What genetic variations in OR2AG2 have been associated with human diseases?

The most significant genetic variation identified in OR2AG2 in relation to human disease is the missense variant rs10839616 (NM_001004490.1:c.161 G > C). This variant has been found to co-segregate with asthma in a multi-generational family study and shows association with asthma in wider population studies . In silico predictions suggest this variant may cause loss of function of the OR2AG2 gene in affected subjects. The variant belongs to a risk haplotype that was found to co-segregate with all affected members of a large family with asthma . Multiple sequence alignment demonstrates that the wild type amino acid at this position is conserved across different species of non-human primates, suggesting evolutionary importance of this residue .

Table 1: Key Genetic Variants in OR2AG2 Associated with Respiratory Conditions

Variant IDNucleotide ChangeProtein EffectAssociated ConditionStudy PopulationFunctional Impact
rs10839616c.161 G > CMissenseAsthmaMulti-generational Indian family and pediatric cohortPredicted loss of function

How does the rs10839616 variant affect the function of OR2AG2?

The rs10839616 (c.161 G > C) variant in OR2AG2 appears to influence the receptor's function in several ways. In silico predictions suggest this variation causes a possible loss of function of the OR2AG2 gene . Phenotypic studies show that individuals carrying this variant demonstrate relative functional hyposmia compared to control subjects, suggesting impaired olfactory function . Multiple sequence alignment indicates that the wild-type amino acid is conserved across different species of non-human primates, underlining the evolutionary importance of this residue . The variant potentially affects the receptor's ability to sense odorant molecules and trigger appropriate downstream signaling, which may impact both olfactory function and respiratory responses. Mechanistically, the variant might alter the receptor's binding pocket or influence G-protein coupling, affecting signal transduction pathways crucial for receptor function.

What is the relationship between OR2AG2 genetic variations and asthma pathophysiology?

Research indicates that OR2AG2 contributes to asthma pathophysiology through several potential mechanisms. The genetic variant rs10839616 in OR2AG2 co-segregates with asthma in a multi-generational family and is associated with asthma in population studies . OR2AG2 is hypothesized to play a role in sensing strong odorant molecules from the environment, which can activate ciliary movements for mucus clearance . When defective, this process may activate sensory neurons in the airways, potentially triggering exacerbation in asthmatics. Expression studies demonstrate that OR2AG2 levels are significantly decreased in lung tissues of asthma patients compared to controls, suggesting downregulation of this receptor may be a feature of asthma pathology . IL-13, a key cytokine in asthma, has been shown to suppress OR2AG2 expression, indicating that cytokine-mediated suppression of OR2AG2 may be one mechanism contributing to asthma pathogenesis .

What are the optimal methods for expressing recombinant OR2AG2 protein for structural studies?

Based on challenges faced when studying olfactory receptors in general, researchers investigating OR2AG2 should consider several approaches for optimal expression of recombinant protein. Expression systems such as wheat germ cell-free systems have been used successfully for other olfactory receptors and might be appropriate for OR2AG2 . Heterologous expression systems may provide a useful model, particularly since the challenges of low expression levels and protein instability are common with olfactory receptors . When designing expression constructs, researchers should consider adding stabilizing modifications such as fusion partners, thermostabilizing mutations, or truncations that maintain the integrity of the binding pocket while enhancing expression yields . For structural studies, modern approaches like cryo-electron microscopy combined with computational methods such as molecular dynamics simulations can help overcome the inherent challenges in obtaining high-resolution structures of olfactory receptors .

How can researchers effectively measure OR2AG2 activation and function in experimental settings?

Several complementary approaches can be employed to measure OR2AG2 activation and function. Calcium imaging assays can detect intracellular calcium flux following receptor activation, providing a real-time measure of signaling. BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer) assays can monitor G-protein coupling and activation. For olfactory function specifically, researchers can use olfactory identification and threshold tests, similar to those employed in studying the rs10839616 variant, which used 2-phenylethyl alcohol (PEA) as a test odorant . In the context of respiratory function, assays measuring ciliary beat frequency, mucus production, or smooth muscle contraction in relevant cell types would provide insights into OR2AG2's functional impact on respiratory physiology . Reporter gene assays in heterologous expression systems can also provide high-throughput screening capabilities for potential ligands or modulators of OR2AG2.

Table 2: Experimental Methods for Studying OR2AG2 Function

MethodApplicationMeasurementStrengthsLimitations
Olfactory Threshold TestsPhenotypic assessmentSensitivity to odorants (e.g., PEA)Direct functional assessmentSubjective; influenced by non-genetic factors
Real-time PCRExpression analysismRNA levelsQuantitative; established for OR2AG2Doesn't measure protein levels or activity
Molecular Dynamics SimulationStructural analysisBinding dynamics, conformational changesCan predict ligand interactionsRequires validation with experimental data
IL-13 Stimulation AssaysRegulatory mechanismsExpression changesModels inflammatory contextsMay not reflect all regulatory pathways

What advanced computational methods can enhance OR2AG2 research?

Molecular dynamics simulations represent a powerful tool for studying OR2AG2, allowing researchers to investigate the receptor's structural dynamics and ligand interactions at the atomic level . These simulations can predict how odorant molecules bind to the receptor and the conformational changes that occur during activation. Integration of AlphaFold2's protein structure prediction with molecular dynamics simulations has significantly broadened applications in deciphering molecular mechanisms and protein-ligand interactions . For OR2AG2 specifically, computational approaches can help identify potential binding sites, predict the effects of genetic variants like rs10839616 on receptor structure and function, and screen for potential ligands. By combining computational predictions with experimental validation, researchers can accelerate the characterization of OR2AG2's structural and functional properties, overcoming some of the inherent challenges in studying olfactory receptors experimentally.

How does OR2AG2 signaling intersect with inflammatory pathways in respiratory diseases?

OR2AG2 signaling appears to intersect with inflammatory pathways in respiratory diseases in multiple ways. Most notably, research has demonstrated that IL-13, a key cytokine in type 2 inflammation characteristic of allergic asthma, leads to suppression of OR2AG2 expression . This finding suggests that inflammatory mediators can modulate OR2AG2 levels, potentially contributing to altered olfactory and respiratory function in inflammatory conditions. The downregulation of OR2AG2 observed in asthmatic lung tissues further supports this connection between OR2AG2 and inflammatory processes . Functionally, OR2AG2 may influence mucociliary clearance, which plays an important role in removing inflammatory stimuli from the airways . Defects in this process could potentially exacerbate inflammatory responses. Based on studies of related olfactory receptors, OR2AG2 signaling likely involves cAMP-dependent pathways that could interact with inflammatory signaling cascades in airway cells.

What is the significance of OR2AG2 expression in non-olfactory tissues?

The expression of OR2AG2 in non-olfactory tissues, particularly the lungs, suggests important functions beyond olfactory sensation. In the respiratory system, OR2AG2 is hypothesized to play a role in sensing strong odorant molecules from the environment, which can activate ciliary movements for mucus clearance . This function would contribute to the innate defense mechanisms of the respiratory tract by facilitating the removal of potentially harmful substances. The decreased expression of OR2AG2 observed in lung tissues from asthma patients suggests that its downregulation may contribute to respiratory pathophysiology . Similar to its paralog OR2AG1, OR2AG2 might also influence airway smooth muscle function, potentially affecting airway responsiveness and tone . The expression pattern of OR2AG2 across different cell types within non-olfactory tissues remains to be fully characterized, which would provide further insights into its physiological roles beyond olfaction.

How do genetic and environmental factors interact to influence OR2AG2 function?

The interaction between genetic and environmental factors in influencing OR2AG2 function represents a complex and important area of research. Genetically, variants such as rs10839616 appear to alter OR2AG2 function, potentially leading to impaired sensing of odorant molecules and altered downstream signaling . Environmentally, exposure to strong odors or volatile compounds could interact with these genetic variants, potentially triggering exacerbations in conditions like asthma through defective sensing and clearance mechanisms . The expression of OR2AG2 is influenced by inflammatory mediators like IL-13, demonstrating how the inflammatory microenvironment can regulate receptor levels and function . The observed olfactory dysfunction in asthmatic individuals suggests that both genetic factors (OR2AG2 variants) and disease-related inflammatory processes contribute to altered olfactory perception . Research investigating how specific environmental exposures interact with OR2AG2 variants to influence respiratory and olfactory function would provide valuable insights into the gene-environment interactions relevant to conditions like asthma.

What therapeutic strategies might target OR2AG2 for respiratory diseases?

Several therapeutic strategies targeting OR2AG2 could be developed for respiratory diseases, particularly asthma. Agonist development could focus on identifying compounds that activate OR2AG2, potentially enhancing mucociliary clearance and airway smooth muscle relaxation. For individuals with loss-of-function variants like rs10839616, gene therapy approaches might restore functional OR2AG2 expression, potentially improving respiratory function . Given that IL-13 suppresses OR2AG2 expression, existing anti-IL-13 therapies might partially restore OR2AG2 function in asthmatic airways . Development of these therapeutic approaches would require further characterization of OR2AG2's precise role in respiratory physiology, identification of selective ligands, and thorough preclinical testing in relevant disease models. The potential for targeting olfactory receptors in respiratory diseases represents a novel therapeutic approach that warrants further investigation.

How might advanced structural biology techniques advance OR2AG2 research?

Advanced structural biology techniques offer significant opportunities for OR2AG2 research despite the challenges inherent in studying olfactory receptors. Cryo-electron microscopy has revolutionized GPCR structural biology, requiring less protein than X-ray crystallography and capturing multiple conformational states . Integration with molecular dynamics simulations can provide insights into conformational changes and ligand binding mechanisms even from lower-resolution structures . AlphaFold2 and related AI-based structure prediction tools could generate initial structural models to guide experimental design . Single-particle analysis techniques could capture OR2AG2 in complex with various ligands or downstream effectors, revealing the structural basis of receptor activation. The recent successful elucidation of the structure of human olfactory receptor OR51E2 provides a methodological blueprint that could be applied to OR2AG2 . High-resolution structures would significantly advance understanding of OR2AG2 function, the impact of genetic variants like rs10839616, and facilitate structure-based drug design targeting this receptor.

Table 3: Phenotypic Characteristics Associated with OR2AG2 Variants in Asthma

PhenotypeAssessment MethodFindings in rs10839616 CarriersFindings in Non-carriers with AsthmaInterpretation
Olfactory FunctionThreshold tests with PEAFunctional hyposmia (detection only at higher concentrations)Similar olfactory dysfunctionSuggests that asthma itself may affect olfaction regardless of genotype
Self-reported Olfactory CapacityDirect questioningDiminished capacityNot specifiedSubjective awareness of olfactory impairment
OR2AG2 ExpressionReal-time PCR of lung samplesDecreasedDecreasedSuggests asthma-associated suppression independent of genetic variant
Response to IL-13In vitro treatmentSuppression of OR2AG2Suppression of OR2AG2Identifies a potential molecular mechanism for decreased expression

What are the most promising approaches for identifying OR2AG2 ligands?

Identifying ligands for OR2AG2 remains challenging due to the vast chemical space of potential odorant molecules. Researchers should consider employing a multi-faceted approach combining experimental and computational methods. High-throughput screening of chemical libraries using functional assays such as calcium imaging or cAMP accumulation in cells expressing OR2AG2 can identify potential activators. Virtual screening approaches utilizing molecular docking and molecular dynamics simulations can predict potential ligands based on binding pocket characteristics . The knowledge that OR2AG2 is implicated in sensing strong odorant molecules that can trigger asthma exacerbations provides a starting point for candidate molecule selection . Based on the paralog OR2AG1's known function in airway smooth muscle cells, researchers might specifically test molecules known to affect smooth muscle contraction/relaxation as potential OR2AG2 ligands . Understanding the binding mechanisms of OR2AG2 would advance both basic science understanding of olfactory receptor function and potentially lead to the development of therapeutic modulators for conditions like asthma.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.