Recombinant Human Olfactory receptor 2AK2 (OR2AK2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on your location and the purchase method. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, centrifuge the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
OR2AK2; OR2AK1P; Olfactory receptor 2AK2; Olfactory receptor 2AK1; Olfactory receptor OR1-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2AK2
Target Protein Sequence
MNISDVISFDILVSAMKTGNQSFGTDFLLVGLFQYGWINSLLFVVIATLFTVALTGNIML IHLIRLNTRLHTPMYFLLSQLSIVDLMYISTTVPKMAVSFLSQSKTIRFLGCEIQTYVFL ALGGTEALLLGFMSYDRYVAICHPLHYPMLMSKKICCLMVACAWASGSINAFIHTLYVFQ LPFCRSRLINHFFCEVPALLSLVCQDTSQYEYTVLLSGLIILLLPFLAILASYARVLIVV FQMSSGKGQAKAVSTCSSHLIVASLFYATTLFTYTRPHSLRSPSRDKAVAVFYTIVTPLL NPFIYSLRNKEVTGAVRRLLGYWICCRKYDFRSLY
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19569

KEGG: hsa:391191

STRING: 9606.ENSP00000355436

UniGene: Hs.690413

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2AK2 and what is its genomic classification?

OR2AK2 (olfactory receptor family 2 subfamily AK member 2) is a protein encoded by the OR2AK2 gene in humans, also known by aliases OR1-47 and OR2AK1P . It belongs to the extensive olfactory receptor family, which constitutes the largest gene family in the human genome. OR2AK2 is classified as a G-protein-coupled receptor (GPCR) arising from a single coding-exon gene and shares the characteristic 7-transmembrane domain structure common to many neurotransmitter and hormone receptors . The genomic classification places it within family 2, subfamily AK, reflecting its evolutionary relationships within the olfactory receptor superfamily.

What is the protein structure and key domains of OR2AK2?

OR2AK2 exhibits the canonical structure of olfactory receptors with seven transmembrane domains characteristic of the GPCR superfamily . The protein consists of 335 amino acid residues (full length) as indicated by available recombinant protein information . The transmembrane regions are interconnected by intracellular and extracellular loops that contribute to ligand binding specificity and signal transduction capabilities. The structural arrangement facilitates interaction with G proteins for downstream signal transduction following odorant binding, ultimately contributing to the neuronal response that triggers smell perception . The specific amino acid sequences within the transmembrane domains likely determine the receptor's odorant specificity profile.

How does OR2AK2 function in olfactory signal transduction?

OR2AK2, like other olfactory receptors, functions by interacting with odorant molecules in the nasal epithelium to initiate neuronal responses that trigger smell perception . The signal transduction process begins when volatile compounds bind to the receptor's ligand-binding pocket, inducing conformational changes that activate associated G proteins. This activation initiates a cascade of intracellular signaling events, including cAMP production, calcium influx, or other secondary messenger systems depending on the specific G protein coupled to the receptor . The precise odorant specificity profile of OR2AK2 has not been fully characterized, though databases like M2OR compile experimental data on OR-molecule interactions that may include OR2AK2 . The concentration of odorant molecules significantly influences receptor response, with higher concentrations potentially activating a broader range of receptors.

What protein-protein interactions are known for OR2AK2?

OR2AK2 engages in direct interactions with various proteins and molecules, although the specific interaction partners are not fully cataloged in the provided search results . These interactions have been detected through multiple experimental methods including yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays . The interacting partners likely include components of the olfactory signal transduction pathway such as G proteins, particularly the olfactory-specific G protein (Golf), receptor trafficking proteins (RTPs), and possibly downstream effector molecules. These protein-protein interactions are crucial for proper receptor localization, function, and signal transduction capabilities. Further characterization of the OR2AK2 interactome would provide valuable insights into its functional roles both within and beyond the olfactory system.

What are the expression patterns of OR2AK2 in non-olfactory tissues and what are their implications?

OR2AK2 exhibits a notable expression pattern in non-olfactory tissues, with particularly elevated expression in pathological conditions. Research indicates that OR2AK2 is expressed in approximately 90% of acute myeloid leukemia (AML) samples, while showing limited expression in healthy tissues (less than 30% of samples) . Among normal tissues, OR2AK2 expression has been primarily detected in testis samples . The significant differential expression between AML and healthy tissues suggests potential roles for OR2AK2 in the pathophysiology of AML, possibly contributing to leukemic transformation, progression, or maintenance.

The expression levels of OR2AK2 are not only more widespread in AML samples but also significantly higher compared to those in healthy tissues . This pattern of ectopic expression in cancer tissues parallels findings with other olfactory receptors and may indicate that OR2AK2 could serve as a potential biomarker for AML or even a therapeutic target. The selective expression in testis among healthy tissues is consistent with the phenomenon of cancer-testis antigens, suggesting potential immunotherapeutic applications. Further investigation into the functional consequences of OR2AK2 expression in these non-olfactory contexts is warranted to understand its biological significance fully.

How does OR2AK2 compare to other olfactory receptors in terms of ligand specificity and signaling properties?

The ligand specificity and signaling properties of OR2AK2 relative to other olfactory receptors remain incompletely characterized. The M2OR database, which compiles experimental data on OR-molecule interactions, may contain information on OR2AK2 responses to various odorants, though specific data was not detailed in the search results . Olfactory receptors generally exhibit diverse ligand specificity profiles, with some having narrow specificity for particular molecular structures while others respond to broader ranges of odorants.

Several factors influence receptor response properties:

  • Concentration dependence: Olfactory perception and receptor activation are highly dependent on odorant concentration, with changes in concentration potentially leading to different perceptions of hedonicity or olfactory quality . Lower concentrations may yield no response, while higher concentrations could activate multiple receptors.

  • Stereochemistry sensitivity: Some olfactory receptors, such as OR1A1, demonstrate differential responses to enantiomers, highlighting the importance of molecular stereochemistry in ligand recognition . Whether OR2AK2 exhibits similar stereoselectivity remains to be determined.

  • Assay-dependent variability: Functional studies of ORs often show assay-dependent bias, with receptors potentially responding differently depending on the expression system used . For instance, ligands identified in one cell line (e.g., LNCaP) may not be recognized when the receptor is expressed in another line (e.g., HEK293) .

Comparative analysis of OR2AK2 with other family members would require systematic deorphanization studies using standardized assays across multiple conditions and concentrations to establish its unique response profile.

What is the potential role of OR2AK2 in acute myeloid leukemia pathophysiology?

The high expression of OR2AK2 in approximately 90% of acute myeloid leukemia (AML) samples compared to its limited expression in healthy tissues suggests a potential role in the pathophysiology of AML . While the precise function of OR2AK2 in leukemia remains uncharacterized, several hypotheses can be considered:

  • Oncogenic signaling: OR2AK2 may couple to G proteins that activate proliferative or anti-apoptotic signaling pathways in leukemic cells, contributing to malignant transformation or maintenance.

  • Metabolic regulation: Ectopic expression of OR2AK2 might allow leukemic cells to detect and respond to metabolites or other molecules in the bone marrow microenvironment, potentially conferring growth or survival advantages.

  • Immune evasion: The expression pattern resembling cancer-testis antigens could implicate OR2AK2 in modulating immune recognition of leukemic cells.

  • Transcriptional dysregulation: The expression of OR2AK2 in AML might not be functionally significant but rather a consequence of broader epigenetic or transcriptional dysregulation characteristic of cancer cells.

OR2AK2 was identified among a specific group of 19 olfactory receptors with elevated expression in AML, including OR52B6, OR52H1, OR13D1, and OR52K2 . This pattern suggests a potential coordinated role for these receptors in leukemogenesis. Further functional studies using receptor antagonists, gene silencing approaches, or ligand identification could help elucidate the mechanistic contribution of OR2AK2 to AML development or progression.

What are the optimal methods for expressing recombinant OR2AK2 in heterologous systems?

Expressing functional olfactory receptors in heterologous systems presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on available information on OR2AK2 and general approaches for olfactory receptor expression, the following methodological considerations are important:

  • Expression systems: Several cell lines have been employed for olfactory receptor expression with varying success:

    • The Hana3A cell line, which expresses chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag, is commonly used for luciferase assays (41% of bioassays in the M2OR database)

    • HEK293T cells, often with modifications, are frequently utilized

    • Other systems include yeast-based systems, Xenopus oocytes, and specialized cell lines like ScL21

  • Co-expression factors: Successful functional expression often requires co-transfection with:

    • Receptor trafficking proteins (RTPs), particularly RTP1 and RTP2

    • Receptor expression enhancing protein (REEP)

    • Olfactory G proteins (Gαolf)

    • Appropriate coupling factors

  • Protein tagging strategies: Adding tags may enhance expression, trafficking, and detection:

    • Rho tags at the N-terminus facilitate surface expression

    • His tags (as used in available recombinant OR2AK2) enable purification and detection

    • FLAG or other epitope tags can be useful for immunodetection

  • Vector design considerations: The expression vector should include:

    • Strong promoters appropriate for the chosen cell line

    • Kozak sequence optimization

    • Codon optimization for the expression system

    • Signal sequences to enhance membrane targeting

A systematic comparison of different expression strategies would be valuable for determining optimal conditions for functional OR2AK2 expression. The choice of system should be guided by the intended downstream applications, whether structural studies, ligand screening, or functional characterization.

What assays are most effective for measuring OR2AK2 activation in response to potential ligands?

Multiple assay systems have been developed to measure olfactory receptor activation, each with distinct advantages and limitations. For OR2AK2, considering the information available in the M2OR database and general practices in the field, the following assays may be effective:

Assay TypeMeasurement ParameterAdvantagesLimitationsRelevance to OR2AK2
Luciferase ReporterLuciferase activity downstream of cAMP response elementHigh sensitivity, quantitative, amenable to high-throughputIndirect measure of activation, potential for false positivesMost common assay (41% of OR bioassays)
Calcium ImagingIntracellular Ca²⁺ levels using fluorescent indicatorsReal-time kinetic data, single-cell resolutionTransient signal, requires imaging equipmentDirectly measures key signaling event in OR activation
cAMP AssaysIntracellular cAMP concentrationDirectly measures primary second messengerLess sensitive than amplified reporter systemsMeasures immediate consequence of Gαs/olf coupling
SEAP ReporterSecreted embryonic alkaline phosphatase activitySensitive, non-destructive samplingIndirect measure of activationAlternative to luciferase with distinct advantages
ElectrophysiologyMembrane conductance or currentDirect measure of cellular response, high temporal resolutionLow throughput, technically demandingGold standard for neuronal activation

The choice of assay should consider:

  • Sensitivity requirements: Different assays have varying detection thresholds, which is crucial when testing compounds at low concentrations.

  • Cell line compatibility: The M2OR database highlights that response patterns can vary between cell lines, with ligands identified in one system (e.g., LNCaP) not recognized in another (e.g., HEK293) .

  • Throughput needs: For deorphanization screens, higher-throughput assays like luciferase reporters may be preferable, while detailed characterization might warrant more informative but lower-throughput approaches.

  • Concentration-response relationships: The M2OR database emphasizes the importance of testing multiple concentrations, as receptor response is highly concentration-dependent .

A multimodal approach using complementary assays would provide the most comprehensive characterization of OR2AK2 activation properties.

How can one design experiments to investigate OR2AK2's potential functions in acute myeloid leukemia?

Investigating OR2AK2's potential functions in acute myeloid leukemia (AML) requires a multifaceted experimental approach to establish causal relationships beyond correlation. Based on the observation that OR2AK2 is expressed in approximately 90% of AML samples with higher expression levels compared to healthy tissues , the following experimental design strategies are recommended:

  • Expression modulation studies:

    • Loss-of-function: CRISPR-Cas9 knockout, shRNA-mediated knockdown, or dominant-negative mutant expression in AML cell lines expressing OR2AK2

    • Gain-of-function: Overexpression in cell lines with low endogenous expression

    • Readouts: Proliferation, apoptosis, differentiation, migration, colony formation, and xenograft tumor formation

  • Signaling pathway analysis:

    • Characterize G protein coupling specificity (Gαs/olf, Gαi, Gαq, Gα12/13)

    • Map downstream effectors using phosphoproteomic approaches

    • Employ pathway inhibitors to identify critical nodes

    • Perform transcriptomic analysis following receptor activation or inhibition

  • Ligand identification in physiological context:

    • Screen metabolites, lipids, or other small molecules present in bone marrow microenvironment

    • Employ targeted metabolomics of AML samples to identify candidate ligands

    • Develop bioassays using primary AML cells with endogenous OR2AK2 expression

  • Clinical correlation studies:

    • Analyze relationship between OR2AK2 expression levels and clinical outcomes

    • Correlate expression with specific AML subtypes, genetic mutations, or treatment responses

    • Examine potential as a biomarker for disease progression or recurrence

  • Comparative analysis with other overexpressed ORs:

    • Investigate functional redundancy or cooperation with other ORs identified in AML (OR52B6, OR52H1, OR13D1, OR52K2)

    • Determine if they share common signaling pathways or ligands

    • Assess potential for co-regulation or functional interaction

These approaches should be implemented with appropriate controls, including comparison to healthy hematopoietic cells and consideration of cell type-specific effects. Integration of in vitro findings with in vivo models and patient-derived samples would strengthen the translational relevance of the research.

How should researchers analyze OR2AK2 expression data across different tissues and disease states?

Analysis of OR2AK2 expression data across tissues and disease states requires rigorous methodology to ensure reliable interpretation. Based on the approaches used in the AML study and best practices in gene expression analysis, the following analytical framework is recommended:

  • Expression prevalence analysis:

    • Calculate the percentage of samples expressing OR2AK2 within each tissue or disease category

    • Establish appropriate expression thresholds to distinguish true expression from background noise

    • The AML study demonstrated OR2AK2 expression in approximately 90% of AML samples compared to less than 30% of healthy tissue samples

  • Expression level quantification:

    • Use normalized expression units appropriate for the platform (FPKM, TPM, log2 counts)

    • Apply appropriate statistical tests with multiple testing correction

    • Consider both absolute expression values and fold changes relative to control tissues

    • The AML study showed higher OR2AK2 expression levels in AML compared to healthy tissues, even when the receptor was detected in both

  • Tissue specificity metrics:

    • Calculate tissue specificity indices (e.g., tau index, Shannon entropy)

    • Perform enrichment analysis for tissue-specific expression patterns

    • Map expression to specific cell types within heterogeneous tissues when single-cell data is available

    • OR2AK2 showed notable expression specificity, predominantly in testis among healthy tissues

  • Correlation with clinical parameters:

    • Assess relationships between expression levels and disease subtypes, stages, or outcomes

    • Evaluate potential as a diagnostic or prognostic biomarker

    • Perform survival analysis stratified by expression levels

  • Validation through orthogonal methods:

    • Confirm RNA sequencing findings with RT-PCR, as was done for OR2AK2 in the AML study

    • Validate at protein level where possible (immunohistochemistry, western blotting)

    • Cross-reference findings across multiple independent datasets

When interpreting the data, researchers should consider potential confounding factors such as sample purity, batch effects, and the sensitivity limits of detection platforms. The apparent ectopic expression of OR2AK2 in AML highlights the importance of comprehensive tissue panels in expression studies to distinguish true tissue-specific expression from pathological aberrations.

What are the challenges in interpreting structure-function relationships for OR2AK2?

Interpreting structure-function relationships for OR2AK2 presents several significant challenges that researchers must address through careful experimental design and data analysis:

  • Structural information limitations:

    • No high-resolution crystal structure or cryo-EM structure exists for OR2AK2

    • Homology modeling must rely on templates with relatively low sequence identity

    • The 7-transmembrane GPCR architecture is known , but specific binding pocket configurations remain uncertain

  • Ligand identification complexities:

    • Olfactory receptors can respond to structurally diverse ligands

    • Response may be concentration-dependent, with different responses at varying concentrations

    • Stereochemistry significantly impacts ligand recognition, as seen with other ORs like OR1A1

    • Distinguishing primary ligands from secondary activators requires careful dose-response analysis

  • Functional assay variability:

    • Responses show assay-dependent bias, with receptors potentially responding differently depending on the expression system

    • The M2OR database highlights that ligands identified in one cell line may not be recognized in another

    • Different assay readouts (calcium, cAMP, luciferase) may yield varying results for the same receptor-ligand pair

  • Protein modification effects:

    • Post-translational modifications may alter ligand binding or signaling properties

    • Artificial tags used for detection or purification could impact receptor conformation

    • The recombinant OR2AK2 protein available features a His-tag , which may influence structural properties

  • Extrapolation to non-olfactory contexts:

    • Structure-function relationships established in olfactory contexts may not translate to other tissues where OR2AK2 is expressed, such as in AML

    • Different G protein coupling or effector availability in non-olfactory tissues could alter signaling outcomes

    • Microenvironment factors in different tissues may modulate receptor conformation or ligand accessibility

To address these challenges, researchers should employ complementary approaches including computational modeling, site-directed mutagenesis, chimeric receptor analysis, and thorough pharmacological characterization across multiple assay systems. The M2OR database framework, which incorporates detailed information on experimental procedures, stereochemistry, and concentration , provides a valuable template for organizing and interpreting structure-function data for OR2AK2.

How can conflicting data on OR2AK2 function from different experimental systems be reconciled?

Reconciling conflicting data on OR2AK2 function from different experimental systems requires systematic analysis of methodological variables and biological context. The M2OR database highlights that assay-dependent bias is a significant consideration in olfactory receptor research . To address discrepancies in functional data, researchers should:

  • Standardize experimental parameters:

    • Develop a standardized reporting format capturing key variables that may influence results:

      • Cell line and specific cell passage number

      • Expression vector design and transfection method

      • Co-factors expressed (RTPs, G proteins, etc.)

      • Detection system and readout metrics

      • Compound purity, stereochemistry, and concentration

    • The M2OR database's approach to documenting experimental procedures, concentrations, and stereochemistry provides a useful model

  • Perform direct comparative studies:

    • Test the same ligands across multiple assay systems in parallel

    • Establish concentration-response relationships rather than single-point measurements

    • Quantify relative efficacy and potency parameters for consistent comparison

    • The observation that ligands identified in LNCaP cells were not recognized in HEK293 cells illustrates the importance of multi-system validation

  • Account for biological factors:

    • Evaluate receptor expression levels and localization across systems

    • Assess G protein subtype availability in different cell backgrounds

    • Consider the influence of membrane composition on receptor conformation

    • Investigate potential accessory proteins present in some systems but not others

  • Develop reference standards:

    • Establish positive control ligands with well-characterized activity

    • Include benchmark olfactory receptors with known properties for comparison

    • Define clear criteria for distinguishing specific from non-specific responses

  • Apply integrative data analysis:

    • Use machine learning approaches to identify patterns in response data across systems

    • Weight evidence based on methodological rigor and reproducibility

    • The M2OR approach of using assay metadata to estimate response confidence levels for machine learning model training represents a sophisticated integration strategy

What is the potential of OR2AK2 as a biomarker or therapeutic target in acute myeloid leukemia?

OR2AK2 demonstrates several characteristics that suggest potential as a biomarker or therapeutic target in acute myeloid leukemia (AML):

  • Differential expression profile:

    • Expressed in approximately 90% of AML samples, making it a highly prevalent marker

    • Limited expression in healthy tissues (less than 30% of samples), with primary expression in testis among normal tissues

    • Higher expression levels in AML compared to healthy tissues, even when detected in both

    • This expression pattern suggests high sensitivity and specificity as a potential diagnostic or monitoring biomarker

  • Biomarker application considerations:

    • Diagnostic utility: The high prevalence in AML suggests potential for inclusion in diagnostic panels

    • Prognostic potential: Correlation with clinical outcomes would need to be established

    • Minimal residual disease monitoring: Expression levels might track disease burden

    • Patient stratification: Expression patterns may correlate with specific AML subtypes or treatment responses

  • Therapeutic target assessment:

    • Selective expression suggests potential for tumor-specific targeting

    • As a GPCR, OR2AK2 belongs to a druggable protein family with established pharmacological approaches

    • Surface expression would make it accessible to various therapeutic modalities:

      • Small molecule antagonists or inverse agonists

      • Therapeutic antibodies or antibody-drug conjugates

      • CAR-T cell approaches targeting the receptor

    • The testis-restricted expression pattern in healthy tissues resembles cancer-testis antigens, suggesting immunotherapeutic potential

  • Mechanistic considerations:

    • Functional importance in AML pathophysiology would need to be established

    • Co-expression with other olfactory receptors (OR52B6, OR52H1, OR13D1, OR52K2) in AML might indicate potential for redundancy

    • Understanding native ligands or constitutive activity would inform therapeutic development

  • Development challenges:

    • Validation across larger patient cohorts would be necessary

    • Assay development for clinical detection would require standardization

    • Structure-based drug design would be challenging without high-resolution structural data

    • Potential for cross-reactivity with other olfactory receptors would need evaluation

The cancer-specific expression profile of OR2AK2 presents an intriguing opportunity, but further validation studies and functional characterization are essential to establish its viability as a clinically meaningful biomarker or therapeutic target.

How does research on OR2AK2 contribute to our understanding of ectopic expression of olfactory receptors in disease?

Research on OR2AK2 provides valuable insights into the broader phenomenon of ectopic olfactory receptor expression in disease states, particularly cancer. The finding that OR2AK2 is highly expressed in acute myeloid leukemia (AML) contributes to our understanding in several ways:

  • Expanding the catalog of ectopically expressed ORs:

    • OR2AK2 joins a growing list of olfactory receptors found expressed outside the olfactory epithelium

    • It was identified among a specific group of 19 olfactory receptors with elevated expression in AML, including OR52B6, OR52H1, OR13D1, and OR52K2

    • This supports the concept that ectopic OR expression in cancer is not random but involves specific receptor subsets

  • Tissue and disease specificity patterns:

    • OR2AK2 shows a distinctive expression pattern with high prevalence in AML (90% of samples) and limited expression in healthy tissues (primarily testis)

    • This pattern differs from other ORs that may have broader non-olfactory expression profiles

    • Understanding these diverse patterns helps elucidate the regulatory mechanisms controlling OR gene expression

  • Conceptual frameworks for ectopic expression:

    • The expression pattern of OR2AK2 in testis and AML resembles that of cancer-testis antigens

    • This suggests potential shared regulatory mechanisms, such as epigenetic control through DNA methylation or histone modifications

    • The phenomenon may reflect dedifferentiation or alternative differentiation pathways in cancer cells

  • Functional implications beyond olfaction:

    • The coordinated expression of multiple ORs in AML suggests potential functional significance rather than random dysregulation

    • ORs may serve as chemosensors for metabolites or other molecules in non-olfactory tissues

    • These receptors could potentially contribute to disease processes through canonical G protein signaling or non-canonical pathways

  • Methodological advances in OR research:

    • The identification of OR2AK2 in AML exemplifies the value of mining RNA-sequencing data for OR expression

    • The confirmation through orthogonal methods (RT-PCR) demonstrates robust approaches to validate OR expression findings

    • These methodological approaches can be applied to investigate OR expression in other diseases

The study of OR2AK2 in AML contributes to an emerging paradigm shift in our understanding of olfactory receptors, expanding their role beyond odorant detection to potential functions in diverse physiological and pathological processes. This broader context enhances the significance of OR2AK2 research beyond its specific role in AML, connecting it to fundamental questions about tissue-specific gene regulation and the repurposing of sensory receptors in disease contexts.

What are the most significant knowledge gaps in OR2AK2 research that should be addressed in future studies?

Despite the insights gathered from existing research, significant knowledge gaps remain in our understanding of OR2AK2. Addressing these gaps would substantially advance both basic science knowledge and potential clinical applications:

  • Structural characterization:

    • No high-resolution structure of OR2AK2 is currently available

    • Detailed binding pocket architecture would facilitate ligand discovery and drug design

    • Understanding of the molecular basis for potential ligand specificity is limited

  • Ligand identification and pharmacology:

    • Native ligands (odorants or other molecules) that activate OR2AK2 remain unidentified

    • Pharmacological tools (agonists, antagonists, allosteric modulators) are lacking

    • Dose-response relationships and efficacy measures need characterization

    • Potential for constitutive activity has not been thoroughly investigated

  • Signaling mechanisms:

    • G protein coupling preferences in different cellular contexts are undefined

    • Downstream signaling pathways, particularly in non-olfactory contexts like AML, are unexplored

    • Potential for non-canonical signaling mechanisms requires investigation

    • Integration with other cellular signaling networks remains to be elucidated

  • Functional significance in AML:

    • Causal relationship between OR2AK2 expression and leukemic phenotypes is unestablished

    • Mechanisms driving OR2AK2 upregulation in AML are unknown

    • Potential coordination with other overexpressed ORs requires clarification

    • Clinical correlations with disease subtypes, progression, or outcomes need investigation

  • Regulatory mechanisms:

    • Transcriptional and epigenetic control of OR2AK2 expression is poorly understood

    • Factors controlling tissue-specific expression patterns remain to be identified

    • Post-transcriptional regulation, including mRNA stability and translation efficiency, is unexplored

    • Post-translational modifications and their functional consequences are uncharacterized

  • Therapeutic development opportunities:

    • Validation as a biomarker across larger, diverse patient cohorts is needed

    • Feasibility as a therapeutic target requires functional validation

    • Development of OR2AK2-targeted compounds or biologics is in its infancy

    • Potential immunotherapeutic approaches leveraging the restricted expression pattern remain unexplored

Future research addressing these knowledge gaps should employ multidisciplinary approaches integrating structural biology, pharmacology, cell signaling, cancer biology, and clinical research. The M2OR database framework for experimental standardization and data integration could serve as a valuable model for systematically advancing OR2AK2 research and facilitating comparison across studies.

What are the recommended best practices for researchers beginning work with OR2AK2?

Researchers embarking on OR2AK2 studies should adopt the following best practices to ensure rigorous, reproducible, and maximally informative research:

  • Experimental system selection and validation:

    • Choose expression systems carefully based on research questions

    • Consider the Hana3A cell line for initial functional studies, as it includes essential co-factors for OR expression

    • Validate receptor expression through multiple methods (western blot, immunofluorescence, flow cytometry)

    • Confirm surface localization rather than just total expression

    • Include appropriate positive controls (well-characterized ORs) and negative controls

  • Recombinant protein considerations:

    • When using commercially available recombinant OR2AK2 , verify protein quality and activity

    • Consider the impact of tags (e.g., His-tag) on protein function

    • For custom expression, optimize constructs for the intended expression system

    • Include appropriate chaperones and trafficking proteins to enhance functional expression

  • Assay design and execution:

    • Test multiple assay formats given the variability in OR responses across systems

    • Establish full concentration-response relationships rather than single-point measurements

    • Include appropriate positive controls for assay validation

    • Consider the impact of assay timing, as GPCR responses can be transient

    • Document all experimental conditions comprehensively following M2OR database principles

  • Data analysis and interpretation:

    • Apply rigorous statistical methods appropriate for the data structure

    • Consider both statistical and biological significance

    • Present complete data sets including negative results

    • Validate key findings through orthogonal methods

    • Place findings in context of existing literature on ORs generally and OR2AK2 specifically

  • Clinical or pathological studies:

    • Ensure adequate sample sizes with appropriate controls

    • Account for potential confounding factors (age, sex, ethnicity, treatment history)

    • Validate findings across independent patient cohorts

    • Correlate expression with detailed clinical parameters and outcomes

    • Consider single-cell approaches to resolve cellular heterogeneity in complex samples

  • Interdisciplinary collaboration:

    • Engage experts in complementary fields (structural biology, pharmacology, cancer biology)

    • Utilize specialized core facilities for advanced techniques

    • Consider consortium approaches for larger-scale characterization efforts

    • Share reagents, protocols, and data to accelerate collective progress

  • Data sharing and standardization:

    • Report findings using standardized nomenclature

    • Deposit data in appropriate repositories (GenBank, PDB, etc.)

    • Provide detailed methodological reporting following M2OR principles

    • Consider pre-registration of experimental plans for clinical studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.