Recombinant Human Olfactory receptor 2AP1 (OR2AP1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Identification

  • Gene: OR2AP1 (Olfactory Receptor Family 2 Subfamily AP Member 1)

  • UniProt ID: Q8NGE2

  • Sequence Length: 309 amino acids

  • Chromosomal Location: 12p13.2

Heterologous Expression Challenges

OR2AP1, like many ORs, exhibits poor surface expression in standard HEK293 cells due to endoplasmic reticulum retention . Functional studies require specialized systems:

Cell LineEfficiencyKey ModificationsStudy Findings
HEK293LowRTP1S, Gαolf co-expressionLimited ligand detection
LNCaPHighEndogenous chaperones (e.g., RTP1)Identified novel ligands for OR2AP1

Ligand Screening

OR2AP1 was included in high-throughput screens using luciferase-based cAMP assays. Despite challenges, LNCaP cells enabled deorphanization of receptors with high basal activity . No specific ligands have been publicly reported for OR2AP1 as of 2025 .

Predicted 3D Structure

AlphaFold2 modeling predicts a canonical GPCR fold with:

  • Ligand-binding pocket: Formed by TM3, TM5, and TM6 helices .

  • Metal ion-binding sites: Potential zinc/copper coordination in ECL2, implicated in thiol detection .

Physiological Roles

  • Olfaction: OR2AP1 contributes to odor discrimination via combinatorial coding .

  • Extranasal functions: ORs are implicated in sperm chemotaxis and neuroendocrine regulation, though OR2AP1’s role remains unconfirmed .

Therapeutic Potential

OR2AP1 is cataloged in Pharos (Target ID: Q8NGE2) as a dark target with no known drugs. Its structure-function data could aid in:

  • Designing biosensors for environmental volatiles .

  • Investigating neurodegenerative links via metalloprotein dysfunction .

Limitations and Future Directions

  • Ligand specificity: OR2AP1’s activation profile is undetermined due to assay-dependent biases .

  • Structural validation: No experimental structures exist; AlphaFold predictions require functional testing .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
OR2AP1; OR2AP1P; Olfactory receptor 2AP1; Olfactory receptor OR12-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2AP1
Target Protein Sequence
MKNKTVLTEFILLGLTDVPELQVAVFTFLFLAYLLSILGNLTILILTLLDSHLQTPMYFF LRNFSFLEISFTNIFIPRVLISITTGNKSISFAGCFTQYFFAMFLGATEFYLLAAMSYDR YVAICKPLHYTTIMSSRICIQLIFCSWLGGLMAIIPTITLMSQQDFCASNRLNHYFCDYE PLLELSCSDTSLIEKVVFLVASVTLVVTLVLVILSYAFIIKTILKLPSAQQRTKAFSTCS SHMIVISLSYGSCMFMYINPSAKEGDTFNKGVALLITSVAPLLNPFIYTLRNQQVKQPFK DMVKKLLNL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15335

KEGG: hsa:121129

STRING: 9606.ENSP00000323423

UniGene: Hs.742584

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2AP1 and what is its function in human olfactory systems?

OR2AP1 (Olfactory Receptor 2AP1, also known as Olfactory receptor OR12-9) is a member of the large family of human olfactory receptors that functions as an odorant receptor . It belongs to the G protein-coupled receptor (GPCR) superfamily, which constitutes the largest protein family in the human genome. The primary function of OR2AP1 is to detect specific odorant molecules and trigger signal transduction pathways that ultimately contribute to odor perception .

OR2AP1 is one of more than 400 olfactory receptors in humans, though the functional properties of more than 80% of these receptors remain unknown, which hampers our understanding of the relationship between receptor function and perception . Characterizing receptors like OR2AP1 is therefore critical to enhancing our understanding of the molecular basis of olfaction.

How is OR2AP1 classified within the broader family of olfactory receptors?

OR2AP1 is classified within the large superfamily of olfactory receptors, which are further organized into families and subfamilies based on sequence homology. The "2" in OR2AP1 designates the family, while "AP" indicates the subfamily, and "1" identifies the specific member within that subfamily.

While the search results don't provide specific information about OR2AP1's phylogenetic relationships, the protein can be found in the UniProt database under accession number Q8NGE2 . In the context of functional studies, OR2AP1 was included in a group of 34 receptors that were tested during later screening phases, suggesting it may have unique characteristics that required specialized approaches for characterization .

What expression systems are most effective for recombinant OR2AP1 production?

The choice of expression system for OR2AP1 depends on the research objectives. For protein production and biochemical characterization, HEK-293 cells have been successfully used to express recombinant OR2AP1 with a His tag, achieving purity levels greater than 90% as determined by Bis-Tris PAGE and Western Blot analysis .

Table 1: Comparison of Expression Systems for OR2AP1 Studies

Cell LineAdvantagesLimitationsRecommended Applications
HEK-293Well-established, high transfection efficiency, widely used for ORsMay not support functional expression of all ORsProtein production, standard functional assays
LNCaPEffective for ORs with high basal activityRequires specialized transfection protocolsFunctional studies of challenging ORs
HuH7/HepG2Alternative systems for OR expressionRequire optimizationTesting OR expression when other systems fail

What transfection methods optimize the functional expression of OR2AP1?

Optimal transfection methods vary significantly depending on the cell line. For functional studies of olfactory receptors including OR2AP1, the following transfection conditions have been reported :

For HEK293 cells:

  • Transfection reagent: 0.41 μL/well of 0.1% polyethylenimine Max (PEI-MAX, pH 7.4)

  • Buffer: DMEM

  • DNA amounts (96-well format): 0.075 μg OR vector, 0.03 μg CRE-luciferase, 0.03 μg Renilla luciferase, 0.03 μg RTP1S vector

For LNCaP cells:

  • Transfection reagent: 0.15 μL/well of Lipofectamine 3000 with 2 μL P3000 reagent per 1 μg plasmid

  • Buffer: Opti-MEM

  • DNA amounts: 0.075 μg OR vector, 0.015 μg CRE-luciferase, 0.015 μg Renilla luciferase, 0.03 μg RTP1S vector, 0.03 μg Gαolf vector

Several strategies can enhance the functional expression of OR2AP1:

  • Co-expression with accessory proteins like RTP1S (Receptor Transporting Protein 1, Short) enhances surface expression

  • N-terminal tagging with epitopes like FLAG and the first 20 amino acids of bovine rhodopsin improves trafficking to the plasma membrane

  • Co-expression with Gαolf improves detection of OR-mediated responses in non-HEK293 cell lines

  • Use of poly-D-lysine coated plates improves cell adherence and transfection efficiency

What vector systems and epitope tags are recommended for OR2AP1 expression?

For research applications involving OR2AP1, several vector systems and epitope tags have proven effective:

  • Expression Vectors: The pME18S vector has been successfully used for OR2AP1 expression . This vector supports mammalian expression with appropriate promoters for high-level expression.

  • Epitope Tags:

    • N-terminal FLAG tag: Facilitates detection via commercial anti-FLAG antibodies

    • Rho tag (first 20 N-terminal amino acids of bovine rhodopsin): Enhances surface expression

    • His tag: Enables purification via metal affinity chromatography and detection with anti-His antibodies

  • Tag Combinations: Dual-tagging approaches, such as FLAG-Rho, capitalize on the advantages of each tag - improved expression from Rho and simplified detection from FLAG .

For protein production purposes, a His-tagged OR2AP1 expressed in HEK-293 cells has been successfully purified to >90% purity using one-step affinity chromatography , making this a recommended approach for biochemical and structural studies.

What reporter systems effectively measure OR2AP1 activation?

Luciferase-based reporter systems have been effectively employed to measure the activation of olfactory receptors including OR2AP1. The canonical signaling pathway for ORs involves G protein coupling (typically Gαolf), adenylyl cyclase activation, and increased cAMP production, which can be monitored using cAMP-responsive elements (CRE) driving reporter gene expression .

A dual-luciferase approach offers particular advantages:

  • CRE-dependent firefly luciferase (CRE/luc2PpGL4.29): Provides a quantitative readout of receptor activation through the cAMP pathway

  • Constitutively expressed Renilla luciferase (pRL-CMV): Serves as an internal control to normalize for variations in transfection efficiency and cell number

The optimal ratio of these reporters may depend on the cell type. For HEK293 cells, equal amounts (0.03 μg each in 96-well format) have been used, while for other cell lines like LNCaP, reduced amounts (0.015 μg each) have been employed to accommodate the co-transfection of additional components like Gαolf .

What methodologies are employed to identify potential ligands for OR2AP1?

Ligand identification for olfactory receptors involves systematic screening approaches. While the search results don't provide specific information about identified ligands for OR2AP1, general methodologies include:

  • Primary Screening: Testing the receptor against a diverse panel of odorants at fixed concentrations. OR2AP1 was included in a group of 34 receptors tested in later screening phases, suggesting it may require specialized approaches .

  • Response Validation: Confirming activation using dose-response curves to establish potency (EC50 values) and efficacy (maximum response).

  • Structure-Activity Relationship Analysis: Testing structural analogs of active compounds to define the chemical features required for receptor activation.

  • Cell System Selection: For receptors like OR2AP1 that may have high basal activity or inefficient expression in HEK293 cells, alternative cell lines such as LNCaP may be necessary to detect ligand-induced responses .

  • Functional Confirmation: Verifying that identified ligands activate canonical OR signaling pathways and induce expected cellular responses.

The selection of an appropriate cell system is particularly critical for receptors that may show high basal activity, as LNCaP cells have been shown to be more effective than HEK293 cells for such receptors .

How can researchers address the challenge of high basal activity in OR2AP1 functional studies?

High basal activity—spontaneous signaling in the absence of ligand—can significantly complicate the detection of ligand-induced activation for some olfactory receptors. While the search results don't specifically characterize OR2AP1's basal activity, research indicates that LNCaP cell lines are effective for functional expression of ORs with high basal activity .

Several strategies can address this challenge:

  • Alternative Cell Systems: LNCaP cells appear to provide an environment more conducive to detecting ligand-induced responses for receptors with high basal activity .

  • Signaling Pathway Modulation: Co-expression of phosphodiesterases like PDE1C can modulate cAMP levels and potentially improve the signal-to-noise ratio .

  • Inverse Agonist Screening: Identifying compounds that reduce basal activity can provide tools for subsequent activation studies and confirm constitutive activity.

  • Enhanced Detection Systems: Using higher sensitivity reporters or amplification steps in the detection system can help distinguish ligand-induced signals from baseline activity.

  • Data Normalization: Appropriate statistical analysis and normalization techniques can help identify significant responses above the variable baseline.

Table 2: Components for Functional Assay System of OR2AP1

ComponentFunctionAmount (96-well format)
FLAG-Rho-tagged OR2AP1 vectorExpresses receptor with detection tags0.075 μg
CRE/luc2PpGL4.29cAMP-responsive firefly luciferase0.03 μg (HEK293), 0.015 μg (LNCaP)
pRL-CMVConstitutive Renilla luciferase0.03 μg (HEK293), 0.015 μg (LNCaP)
RTP1S vectorEnhances receptor trafficking0.03 μg
Gαolf vectorCouples receptor to signaling pathwayNot needed (HEK293), 0.03 μg (LNCaP)

What are the critical quality control parameters for recombinant OR2AP1 production?

Quality control of recombinant OR2AP1 should address several key parameters:

  • Purity Assessment: For recombinant OR2AP1 protein, purity levels greater than 90% have been achieved as determined by Bis-Tris PAGE and Western Blot analysis . This represents a benchmark for high-quality preparations.

  • Identity Confirmation: Verification that the expressed protein is indeed OR2AP1 can be accomplished through:

    • Western blotting with tag-specific antibodies (His, FLAG, or Rho)

    • Mass spectrometry analysis of tryptic peptides

    • N-terminal sequencing

  • Structural Integrity: For functional studies, proper folding and membrane insertion are critical. While challenging to assess directly, functional responses to ligands (if known) provide indirect evidence of correct structure.

  • Glycosylation Status: As a membrane protein, OR2AP1 may be glycosylated. The consistency of glycosylation should be monitored, especially when comparing different expression systems.

  • Stability Assessment: Thermal stability assays or time-course activity measurements can verify that the recombinant protein maintains its native conformation under experimental conditions.

For custom-made recombinant OR2AP1, expression in mammalian cells followed by one-step affinity chromatography has proven effective in producing high-quality protein suitable for applications like SDS-PAGE and Western blotting .

How should researchers troubleshoot failed OR2AP1 expression or functional assays?

When encountering difficulties with OR2AP1 expression or functional studies, a systematic troubleshooting approach is recommended:

  • Expression System Evaluation:

    • If HEK293 cells fail to produce functional OR2AP1, consider switching to LNCaP cells, which have been shown to be effective for ORs with high basal activity

    • Verify expression of accessory proteins like RTP1S that enhance OR trafficking

    • For non-HEK293 cells, ensure co-expression of Gαolf to support functional coupling

  • Protein Expression Verification:

    • Confirm protein expression via Western blotting using tag-specific antibodies

    • Assess subcellular localization using immunofluorescence microscopy to verify membrane targeting

    • Consider optimizing codon usage for expression in mammalian systems

  • Assay System Optimization:

    • Adjust reporter construct ratios to ensure adequate sensitivity

    • Optimize cell density and transfection conditions for each cell type

    • Consider testing multiple assay formats (calcium imaging, BRET, etc.) as alternatives to luciferase reporters

  • Ligand Selection:

    • If no responses are observed with initial compounds, expand testing to structurally diverse odorants

    • Consider that OR2AP1 might respond to non-odorant ligands, as ORs can have extranasal functions

    • Test at multiple concentrations, as some responses may only be detectable at higher concentrations

  • Signal Detection:

    • For receptors with high basal activity, standard assays may have insufficient dynamic range

    • Consider baseline subtraction methods or alternative readouts with greater sensitivity

What controls should be included in OR2AP1 functional assays to ensure reliable data interpretation?

Robust experimental design for OR2AP1 functional studies should include several critical controls:

  • Vector Controls:

    • Empty vector transfection to establish baseline responses of the cell system

    • Known functional OR (positive control) to validate the assay system's ability to detect OR activation

    • Non-responsive OR (negative control) to identify non-specific effects

  • Activity Controls:

    • Basal activity measurement in the absence of any compound

    • Forskolin treatment to directly activate adenylyl cyclase as a positive control for the cAMP pathway

    • Vehicle controls matching the solvents used for test compounds

  • Expression Controls:

    • Reporter-only transfection to establish baseline reporter activity

    • GFP co-transfection to monitor transfection efficiency

    • Western blotting of cell lysates to confirm OR2AP1 expression levels

  • Dose-Response Validation:

    • Multiple concentrations of test compounds to establish concentration-dependent effects

    • Known receptor antagonists (if available) to confirm specificity of observed responses

  • Cell System Controls:

    • Comparison between different cell lines (e.g., HEK293 vs. LNCaP) to identify cell-specific effects

    • Testing of OR2AP1 with and without accessory proteins to determine their impact on receptor function

  • Data Normalization:

    • Dual-luciferase approach using constitutively expressed Renilla luciferase to normalize for transfection efficiency and cell number variations

How does OR2AP1 compare to other olfactory receptors in terms of expression efficiency and functional properties?

While the search results don't provide direct comparative data for OR2AP1 versus other olfactory receptors, several inferences can be made:

  • Expression Classification: OR2AP1 was included in a group of 34 receptors that were tested during later screening phases, potentially indicating unique expression characteristics or challenges . This suggests OR2AP1 may not belong to the subset of ORs that express readily in standard systems.

  • Functional Expression Considerations: The research indicating that LNCaP cells are effective for ORs with high basal activity raises the possibility that OR2AP1 might exhibit significant constitutive activity, though this is not explicitly stated in the available data.

  • Deorphanization Status: Like more than 80% of human ORs, OR2AP1 appears to be among the receptors whose ligand specificity and functional properties remain incompletely characterized . This places it among the majority of ORs that present significant challenges for functional characterization.

  • Expression System Requirements: The fact that research groups have employed specialized cell systems like LNCaP for studying certain ORs suggests that OR2AP1 might benefit from these alternative expression platforms, particularly if it exhibits high basal activity or inefficient functional expression in HEK293 cells .

A comprehensive comparative analysis would require systematic expression and functional studies across multiple cell systems, which would be a valuable contribution to the field.

What approaches can researchers use to investigate the potential extranasal functions of OR2AP1?

Olfactory receptors are increasingly recognized to have functions beyond the olfactory epithelium, being expressed in various tissues throughout the body . To investigate potential extranasal functions of OR2AP1:

  • Expression Analysis:

    • RT-PCR and quantitative PCR to detect OR2AP1 mRNA in non-olfactory tissues

    • RNA-seq analysis of different tissue types to identify relative expression levels

    • Immunohistochemistry with validated antibodies to localize the protein within tissues

  • Functional Characterization:

    • Reporter assays in cell lines derived from tissues showing OR2AP1 expression

    • Calcium imaging or other second messenger assays to identify signaling pathways

    • Phenotypic assays measuring cellular responses like migration, proliferation, or metabolic changes

  • Genetic Approaches:

    • CRISPR/Cas9-mediated knockout or knockdown of OR2AP1 in relevant cell types

    • Overexpression studies to identify gain-of-function phenotypes

    • Single-cell transcriptomics to identify cell populations expressing OR2AP1

  • Ligand Identification:

    • Screening of endogenous metabolites or signaling molecules as potential ligands

    • Testing of tissue extracts for activating or inhibitory compounds

    • In silico prediction of potential ligands based on structure-function relationships

  • Physiological Relevance:

    • Animal models with modified OR2AP1 expression to assess systemic effects

    • Ex vivo tissue preparations to study OR2AP1 function in a more native context

    • Correlation of OR2AP1 variants with physiological or pathological phenotypes

The finding that ORs can play critical physiological roles outside the nose suggests that OR2AP1 may have yet-undiscovered functions in non-olfactory contexts.

What are the current challenges and future directions in OR2AP1 research?

Research on OR2AP1 faces several challenges common to the broader field of olfactory receptor biology:

  • Deorphanization Challenge: Identifying the specific ligands that activate OR2AP1 remains a significant hurdle. The fact that more than 80% of human ORs lack characterized ligands highlights the magnitude of this challenge across the OR family.

  • Expression Obstacles: Achieving robust functional expression in heterologous systems is difficult for many ORs, likely due to the absence of factors present in their native cellular environment . Developing improved expression systems remains an important goal.

  • Structural Insights: The absence of crystal structures for most ORs, potentially including OR2AP1, limits understanding of ligand binding mechanisms and receptor activation.

  • Physiological Relevance: Connecting in vitro activation patterns to in vivo odor perception and potential extranasal functions represents a significant knowledge gap.

Future research directions may include:

  • Alternative Expression Systems: Further development and characterization of cell lines like LNCaP that show promise for expressing ORs with high basal activity .

  • High-Throughput Screening: Application of advanced screening technologies to identify ligands for OR2AP1 from larger and more diverse chemical libraries.

  • Structural Biology: Application of cryo-EM or other structural techniques to elucidate the three-dimensional structure of OR2AP1.

  • Systems Biology Approaches: Integration of OR2AP1 into broader olfactory coding networks to understand its contribution to odor perception.

  • Therapeutic Applications: Exploration of potential roles in disease processes or as drug targets, particularly if extranasal functions are identified.

The continued development of improved tools and methodologies for expressing and characterizing challenging receptors like OR2AP1 will be essential for advancing our understanding of the molecular basis of olfaction and the diverse roles of olfactory receptors throughout the body.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.