Recombinant Human Olfactory receptor 2B11 (OR2B11)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Odorant Recognition:

  • OR2B11 binds odorants via a combinatorial code, where activation depends on interactions with specific molecular features (e.g., hydrophobicity, stereochemistry) .

  • Structural studies reveal that ligand binding induces conformational changes in ECL2 and ECL3, triggering downstream signaling .

Key Pathways:

  • GPCR Downstream Signaling: Mediates cAMP and calcium signaling .

  • Olfactory Transduction: Converts odorant binding into neuronal signals .

Research Applications

Experimental Assays:

ApplicationDetails
ELISA/WBDetects OR2B11 expression in cell lysates .
IHC/FCMLocalizes receptor distribution in tissues .
Luciferase AssayMeasures ligand-induced activation in Hana3A cells .

Notable Studies:

  • Ligand Screening: OR2B11 was included in high-throughput screens of 511 human olfactory receptors against 73 odorants .

  • Structural Dynamics: Cryo-EM and molecular dynamics simulations mapped its binding pocket interactions with short-chain fatty acids .

Challenges and Opportunities

Deorphanization:

  • OR2B11 remains partially characterized, with limited confirmed ligands .

  • The M2OR database (51,395 OR-odorant pairs) provides a framework for identifying agonists .

Technical Limitations:

  • Heterologous expression in non-native cell lines (e.g., HEK293) may alter ligand specificity .

  • Tagging can interfere with native conformation, requiring optimization .

Future Directions

  • Machine Learning: Models like PCM predict OR-odorant pairs using sequence and physicochemical data .

  • Disease Links: Potential roles in neurodegenerative disorders via metalloprotein interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
OR2B11; Olfactory receptor 2B11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2B11
Target Protein Sequence
MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD MKGALRRLLARIWRLCG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 31249

KEGG: hsa:127623

STRING: 9606.ENSP00000325682

UniGene: Hs.446999

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2B11 and where is it located in the human genome?

OR2B11 (olfactory receptor, family 2, subfamily B, member 11) is a G protein-coupled receptor belonging to Class A (rhodopsin-like) receptors involved in odorant detection. It is encoded by a gene located on chromosome 1 (245680954-245681907) . OR2B11 is part of the largest mammalian protein superfamily, which includes approximately 400 intact olfactory receptor genes in humans, compared to 1400 in mice . The gene contains a 954 bp open reading frame encoding a seven-transmembrane domain receptor .

How does OR2B11 function within the olfactory system?

OR2B11, like other olfactory receptors, functions through a combinatorial coding mechanism. Rather than binding specific ligands exclusively, it displays affinity for a range of odor molecules, and conversely, a single odorant may bind to multiple receptors with varying affinities . When an odorant binds to OR2B11, the receptor undergoes conformational changes that activate olfactory-type G proteins (Golf and/or Gs), triggering a signaling cascade involving adenylate cyclase activation, cAMP production, and ultimately neuronal depolarization through cyclic nucleotide-gated ion channels . This combinatorial activation pattern allows humans to discriminate thousands of distinct odors using a relatively limited number of receptors .

What expression systems are most effective for producing functional recombinant OR2B11?

Several heterologous expression systems have been successfully used for recombinant olfactory receptor expression:

  • HEK293 and modified HEK293T cells: Standard for OR expression, especially when transiently or stably transfected with the OR gene in a plasmid vector like pCI containing a Rho tag (first 20 residues of human rhodopsin) .

  • Specialized derivative cell lines: Hana3A cells, which are HEK293T cells engineered to express RTP1S (receptor transporting protein), G proteins, and other chaperon proteins that enhance OR surface expression .

  • Xenopus laevis oocytes: Effective for electrophysiological studies, often requiring co-expression of "reporter" channels to measure receptor responses .

For optimal results with OR2B11, the expression construct should include:

  • A strong promoter (like CMV)

  • The Rho tag for improved membrane trafficking

  • Co-transfection with accessory factors like RTP1S and G proteins

What are the critical factors for optimizing functional expression of OR2B11?

Optimizing recombinant OR2B11 expression requires addressing several challenges:

FactorOptimization StrategyRationale
Membrane traffickingInclude N-terminal Rho tag (first 20 residues of rhodopsin)Enhances surface expression
Protein foldingCo-expression with RTP1S (5 ng/well)Acts as chaperon protein
Coupling efficiencyCo-expression with M3 (2.5 ng/well)Enhances G-protein coupling
Signal amplificationCo-transfection with CRE-luciferase (10 ng/well)Provides sensitive readout
Transfection controlCo-transfection with pRL-SV40 (5 ng/well)Internal control for normalization

Additionally, cell culture conditions significantly impact expression:

  • Maintaining cells at 37°C with 5% CO₂

  • Using CD293 media for odor stimulation experiments

  • Allowing 24 hours post-transfection before functional testing

What assays can be used to identify ligands and measure OR2B11 activation?

Several complementary approaches are effective for functional characterization:

  • Luciferase-based reporter assays: The Dual-Glo Luciferase Assay System provides a sensitive readout of receptor activation. When an odorant activates OR2B11, it triggers a signaling cascade that ultimately activates CRE (cAMP response element), driving luciferase expression. This approach requires:

    • Transfection with OR2B11, RTP1S, CRE-luciferase reporter

    • Stimulation with candidate odorants (typically at 100 μM)

    • Measurement of luminescence 4 hours post-stimulation

    • Normalization using Renilla luciferase activity

  • Calcium imaging: Measures intracellular calcium elevation upon receptor activation:

    • Transfect cells with OR2B11

    • Load with calcium-sensitive dye

    • Stimulate with odorants

    • Record fluorescence changes indicating [Ca²⁺] increases

  • High-throughput screening: For deorphanization (identifying ligands):

    • Primary screen: Test compounds at single concentration (100 μM)

    • Secondary screen: Test hit compounds at multiple concentrations (1, 10, 100 μM)

    • Dose-response analysis: Test across concentration range (10 nM to 10 mM)

How should dose-response relationships be established for OR2B11 ligands?

Establishing accurate dose-response relationships requires:

  • Concentration range selection: Test concentrations from 10 nM to 10 mM to capture the full dynamic range .

  • Proper controls:

    • Vector-only control for each odorant

    • Known broadly-tuned receptors as positive controls

    • Standard receptor-ligand pair (e.g., Olfr544/nonanedioic acid) for normalization

  • Data analysis:

    • Fit responses to a sigmoidal curve model

    • Determine EC₅₀ values (concentration producing 50% of maximal response)

    • Confirm significance by ensuring:

      • 95% confidence intervals of top and bottom parameters don't overlap

      • Standard deviation of fitted log EC₅₀ is <1 log unit

      • Odorant activates receptor significantly more than vector control

  • Consideration of concentration-dependent effects: Olfactory perception depends on odorant concentration, with changes affecting both hedonicity and olfactory quality. At the molecular level, increasing ligand concentration results in higher probability of OR activation and broader receptor recruitment .

How do genetic variations in OR2B11 affect receptor function and olfactory perception?

Genetic variation in OR2B11 and other olfactory receptors is abundant and significantly impacts function and perception:

  • Function-perception correlation: Studies examining 276 olfactory phenotypes across 332 individuals identified cases where single OR genetic variations altered odor perception. In 8 out of 10 validated cases, reduced receptor function was associated with reduced intensity perception .

  • Contribution to perceptual variation: In combination with ancestry, age, and gender, single OR genotype can explain 10-20% of perceptual variation in specific olfactory phenotypes .

  • Analysis methods:

    • Sequence OR2B11 in study populations

    • Correlate variants with phenotypic data (intensity/pleasantness ratings, detection thresholds)

    • Validate functional effects using in vitro assays

    • Quantify genetic ancestry to account for population-level differences

What molecular features of OR2B11 determine ligand specificity?

Understanding ligand specificity requires analysis of:

  • Subfamily relationships: OR2B11 belongs to family 2, subfamily B. Members of the same subfamily (≥60% identical in amino acid sequence) often recognize structurally related odorants . Analyzing homology with receptors of known specificity can provide insights into OR2B11 ligand preferences.

  • Key binding residues: Mutation studies of related ORs have identified critical residues in transmembrane domains that determine ligand specificity. Comparative sequence analysis between OR2B11 and related receptors with known ligand preferences can highlight potential specificity-determining residues .

  • Homology to characterized receptors: Rodent ORs with known function often have human homologs with 62-87% sequence identity. This high similarity suggests they likely recognize similar odorant structures. Identifying the closest rodent homolog to OR2B11 can provide clues about its ligand specificity .

How can computational approaches aid OR2B11 research?

Several computational strategies enhance OR2B11 research:

  • Database utilization: The Molecule to Olfactory Receptor database (M2OR) contains 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs, including information about:

    • OR responses to molecules and mixtures

    • Receptor sequences

    • Experimental details (cell lines, assay types)

    • Non-responsive experiments (important negative data)

    • Stereochemistry properties and tested concentrations

  • Structure prediction: Although no crystal structure exists for OR2B11, homology modeling based on other GPCRs can predict:

    • Transmembrane domain organization

    • Potential ligand binding pockets

    • Effects of genetic variants on structure

  • Virtual screening: Computational docking of virtual compound libraries against OR2B11 models can identify potential ligands for experimental validation, accelerating deorphanization efforts.

What genetic engineering approaches can be used to modify OR2B11 for research applications?

Several genetic engineering strategies can be applied:

  • Recombineering for bacterial expression: Using homologous recombination methods to create genetic constructs:

    • PCR amplification of OR2B11 with appropriate homology arms

    • Introduction into recombination-competent bacteria (expressing λ Red or RecET systems)

    • Selection of recombinants using antibiotic markers

    • Verification by colony PCR and sequencing

  • Point mutation introduction: For structure-function studies:

    • Using single-stranded DNA oligonucleotides (~70 nt long)

    • Centrally locating desired mutations in the oligo

    • Achieving 0.1-1% efficiency in standard strains

    • Reaching 25-50% efficiency in mismatch repair-deficient strains (mutS, mutH, mutL, or uvrD mutants)

  • Chimeric receptors: Creating OR2B11 chimeras with other ORs or GPCRs to:

    • Investigate domain-specific functions

    • Enhance expression or coupling efficiency

    • Modify ligand specificity profiles

  • Reporter tagging: Adding fluorescent or luminescent tags to monitor:

    • Subcellular localization

    • Trafficking dynamics

    • Protein-protein interactions

What are common challenges in OR2B11 research and how can they be addressed?

ChallengeSolutionImplementation Details
Poor surface expressionOptimize traffickingUse Rho tag (first 20 residues of rhodopsin); co-express RTP1S, RTP2, and REEP1 chaperones
Low signal-to-noise ratioEnhance signal detectionUse CRE-luciferase reporter; normalize with Renilla luciferase; include positive and negative controls
Assay-dependent biasCross-validate in multiple systemsTest in different cell lines (HEK293, Hana3A); compare results from different assay types (calcium imaging vs. luciferase)
Stereoisomer confusionEnsure stereochemical precisionUse pure stereoisomers rather than racemic mixtures; verify stereochemistry of test compounds
Concentration-dependent effectsTest across concentration rangeEstablish full dose-response curves (10 nM to 10 mM); report EC₅₀ values

How can the combinatorial nature of olfactory coding be addressed in OR2B11 research?

Addressing combinatorial coding requires:

  • Comprehensive ligand profiling: Test OR2B11 against diverse odorant panels to establish its response spectrum within the combinatorial code .

  • Multi-receptor analysis: Examine OR2B11 alongside other receptors to understand how they collectively encode odor perception:

    • Test the same odorant panel against multiple receptors

    • Identify patterns of co-activation

    • Correlate receptor activation patterns with perceptual data

  • Negative data inclusion: Document non-responsive OR-odorant pairs, as these are integral to the combinatorial code. The M2OR database uniquely includes this important information, with 48,295 non-responsive pairs compared to 3,100 active pairs (6% activation rate) .

  • Integration with perceptual data: Correlate OR2B11 activation with human psychophysical data to connect molecular mechanisms with perception:

    • Intensity ratings

    • Pleasantness scores

    • Detection thresholds

    • Odor quality descriptors

This comprehensive approach helps unravel how OR2B11 functions within the broader context of human olfactory perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.