Recombinant Human Olfactory receptor 2B2 (OR2B2)

Shipped with Ice Packs
In Stock

Description

Molecular and Genomic Context

OR2B2 is encoded by the OR2B2 gene located on human chromosome 6. Key genomic features include:

  • Gene ID: 81697

  • Protein Accession: NP_149046.2 (NCBI), Q9GZK3 (UniProt) .

  • Classification: Class II olfactory receptor (tetrapod-specific), Family 2, Subfamily B .

Olfactory receptors like OR2B2 share a conserved seven-transmembrane domain structure and couple to G-proteins to initiate signaling cascades upon odorant binding . The OR2B2 gene is part of the largest gene family in the human genome, with over 800 olfactory receptor genes .

Recombinant OR2B2 Protein Characteristics

Recombinant OR2B2 is produced in heterologous expression systems (e.g., E. coli or mammalian cells) to enable biochemical and functional studies. Key specifications from commercial sources include:

ParameterDetails
Product NameRecombinant Human Olfactory Receptor 2B2 (partial)
Catalog NumberMBS7098631
Host SpeciesHuman
Expression SystemNot explicitly stated (typical systems include HEK293 or insect cell lines)
ApplicationsELISA, Western Blot, functional assays
Sequence CoveragePartial sequence (exact regions unspecified)
Purity>95% (estimated via SDS-PAGE)

Source: MyBioSource .

3.1. Expression in Non-Olfactory Tissues

OR2B2 is aberrantly expressed in certain cancers:

  • Breast Carcinoma: Detected in 70% of breast carcinoma cell lines and 66% of tumor tissues, but absent in healthy breast tissues .

  • Lung and Pancreatic Cancers: Moderately expressed in subsets of lung (30%) and pancreatic carcinomas .

This ectopic expression suggests OR2B2 may serve as a tumor biomarker, though its functional role in oncogenesis remains unclear .

3.2. Functional Insights

  • Ligand Specificity: No confirmed ligands for OR2B2 have been identified, complicating functional studies .

  • Fusion Transcripts: In breast cancer, OR2B6 (a related receptor) forms a fusion transcript with histone HIST1H2BO, potentially influencing gene regulation . Whether OR2B2 participates in similar mechanisms is unknown.

Technical Challenges

  • Heterologous Expression: OR2B2, like most olfactory receptors, is difficult to express in standard cell lines due to trafficking issues. Chaperone proteins (e.g., RTP1/2) are often required for proper membrane localization .

  • Assay Variability: Functional responses can vary depending on the cell line (e.g., Hana3A vs. HEK293) .

Applications in Research

Recombinant OR2B2 is primarily used for:

  1. Antibody Development: Polyclonal antibodies against OR2B2 are available for Western blot and immunohistochemistry .

  2. Odorant Screening: High-throughput assays (e.g., luciferase-based systems) to identify potential ligands .

  3. Cancer Studies: Investigating its role in tumor progression and metastasis .

Unresolved Questions

  • Does OR2B2 contribute to cancer cell migration or proliferation?

  • What odorants or endogenous molecules activate OR2B2?

  • Are there splice variants or post-translational modifications affecting its function?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
OR2B2; OR2B9; Olfactory receptor 2B2; Hs6M1-10; Olfactory receptor 2B9; Olfactory receptor 6-1; OR6-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2B2
Target Protein Sequence
MNWVNKSVPQEFILLVFSDQPWLEIPPFVMFLFSYILTIFGNLTIILVSHVDFKLHTPMY FFLSNLSLLDLCYTTSTVPQMLVNICNTRKVISYGGCVAQLFIFLALGSTECLLLAVMCF DRFVAICRPLHYSIIMHQRLCFQLAAASWISGFSNSVLQSTWTLKMPLCGHKEVDHFFCE VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIQSAEGQRKAFGT CGSHLIVVSLFYGTAISMYLQPPSPSSKDRGKMVSLFCGIIAPMLNPLIYTLRNKEVKEA FKRLVAKSLLNQEIRNMQMISFAKDTVLTYLTNFSASCPIFVITIENYCNLPQRKFP
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 13966

KEGG: hsa:81697

STRING: 9606.ENSP00000304419

UniGene: Hs.307111

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory Receptor 2B2 and what are its key identifiers?

Human Olfactory Receptor 2B2 (OR2B2) is a G protein-coupled receptor involved in olfactory signal transduction. It belongs to the large family of olfactory receptors that detect odorants in the nasal epithelium and trigger neuronal responses. Key identifiers for OR2B2 include:

ParameterIdentifier
UniProt Primary AccessionQ9GZK3
UniProt Entry NameOR2B2_HUMAN
Gene SymbolOR2B2
KEGGhsa:81697

The receptor is encoded by an intronless gene and is part of the human olfactory system capable of discriminating numerous odors . Understanding these identifiers is crucial when sourcing materials and comparing research findings across different studies.

How do recombinant OR2B2 preparations differ from native receptor samples?

Recombinant OR2B2 preparations may have different sequences or tertiary structures compared to native proteins, which can significantly impact experimental outcomes. Commercial kits are typically optimized for detection of native samples rather than recombinant proteins . When using recombinant OR2B2:

  • Expect potential differences in binding affinity and specificity

  • Verification of proper folding is essential

  • Post-translational modifications present in native receptors may be absent

  • Detection sensitivity may be lower compared to native samples

Researchers should carefully validate recombinant OR2B2 against native controls when possible, as the structural differences can affect experimental outcomes, particularly in binding and functional assays .

What are the recommended sample types for OR2B2 detection and analysis?

For optimal OR2B2 detection and analysis, researchers should consider several sample types:

  • Tissue homogenates from olfactory epithelium

  • Cell lysates from heterologous expression systems

  • Biological fluids with appropriate controls

Sample preparation is crucial for maintaining receptor integrity. For tissue homogenates, fresh samples should be processed quickly to prevent protein degradation. Cell lysates from expression systems like Hana3A cells provide a controlled environment for receptor expression and are commonly used in functional studies . When using biological fluids, potential interferents should be removed through appropriate purification steps to ensure specific detection of OR2B2 .

How should heterologous expression systems be optimized for OR2B2 functional studies?

Optimizing heterologous expression systems for OR2B2 functional studies requires careful consideration of several factors:

  • Cell line selection: Hana3A cells are preferred for olfactory receptor studies due to their enhanced receptor trafficking and coupling to signaling cascades .

  • Co-expression factors: Include RTP1S (5 ng/well), which enhances receptor trafficking to the cell surface .

  • Vector design: Use expression vectors containing the first 20 residues of human rhodopsin (Rho tag) to improve cell surface expression .

  • Transfection optimization:

    • For luciferase assays: 5 ng/well of OR2B2, 5 ng/well of RTP1S, 5 ng/well of pRL-SV40, 10 ng/well of CRE-luciferase, and 2.5 ng/well of M3

    • Maintain consistent DNA ratios between experiments

  • Expression verification: Confirm receptor expression through Western blotting or immunocytochemistry prior to functional assays .

These optimization steps significantly improve the likelihood of successful OR2B2 expression and functionality in heterologous systems, which is essential for accurate ligand identification and characterization studies .

What are the critical parameters for designing dose-response experiments with OR2B2?

Designing robust dose-response experiments for OR2B2 requires attention to several critical parameters:

  • Concentration range: Use a wide concentration range from 10 nM to 10 mM to capture the complete dose-response relationship .

  • Controls: Include vector-only controls for each odorant to account for non-specific effects .

  • Replication: Test each odorant-receptor dose in triplicate, with each measurement collected from separate wells using cells from the same parent plate .

  • Data fitting: Fit response data to a sigmoidal curve and apply statistical validation:

    • Confirm non-overlapping 95% confidence intervals between top and bottom parameters

    • Ensure standard deviation of fitted log EC50 is less than 1 log unit

    • Apply extra sums-of-squares test to confirm odorant activation relative to control

  • Normalization: Normalize results to a standard receptor-ligand pair (e.g., Olfr544 with nonanedioic acid) to enable comparison across experimental runs .

These parameters ensure reliable quantification of OR2B2 responses and enable accurate determination of ligand potency and efficacy .

How should odorant delivery be standardized in OR2B2 experiments?

Standardizing odorant delivery is crucial for reproducible OR2B2 experiments. Implement the following procedures:

  • Odorant preparation:

    • Prepare 1M odorant stocks in DMSO for hydrophobic compounds

    • Use water for diluting water-soluble compounds (e.g., amines)

    • Store in amber glass vials to prevent photodegradation

  • Delivery system setup:

    • Use a flow dilution olfactometer with computer-controlled mass-flow controllers

    • Implement dual synchronous three-way solenoid valves to alternate between odorized and clean air

    • Maintain impedance-matched flow lines to prevent pressure spikes

  • Dilution protocol:

    • Prepare serial dilutions in appropriate solvents

    • Further dilute headspace ten-fold via flow prior to delivery

    • Document final delivered concentrations in molar terms

  • Contamination prevention:

    • Test only one odorant per day to avoid cross-contamination

    • Interleave odor trials with clean air trials

    • Replace mixing chambers and valves if contamination is detected

This standardized approach ensures consistent odorant presentation across experiments and facilitates comparison between different studies .

What screening approaches are most effective for identifying OR2B2 ligands?

Effective screening for OR2B2 ligands requires a multi-stage approach to efficiently identify and validate potential binding partners:

  • Primary screen design:

    • Challenge 511 human ORs with a diverse panel of 73 odorants at 100 μM concentration

    • Include broadly-tuned odorant receptors (Olfr1079, OR2W1, Olfr1377, Olfr73, Olfr1341) as positive controls

    • Incorporate standard receptor (e.g., Olfr544) with known ligand (nonanedioic acid) for normalization

    • Include no-odor control plates to establish baseline activity

  • Secondary screen implementation:

    • Select top 5% of odorant/receptor pairs from primary screen

    • Test responses at multiple concentrations (1, 10, and 100 μM)

    • Perform all comparisons in triplicate from separate wells

    • Standardize each plate by setting the known receptor-ligand response to a value of 1

  • Dose-response validation:

    • Construct full dose-response curves for promising candidates

    • Test concentrations ranging from 10 nM to 10 mM

    • Include vector-only controls for each odorant

    • Apply rigorous statistical criteria to confirm agonist activity

This systematic approach maximizes the likelihood of identifying genuine OR2B2 ligands while minimizing false positives and resource expenditure .

How can luciferase assays be optimized for measuring OR2B2 activation?

Optimizing luciferase assays for OR2B2 activation requires precise control of multiple experimental parameters:

  • Transfection protocol optimization:

    • Transfect Hana3A cells with: 5 ng/well RTP1S, 5 ng/well pRL-SV40, 10 ng/well CRE-luciferase, 2.5 ng/well M3, and 5 ng/well of OR2B2

    • Use consistent DNA:transfection reagent ratios across experiments

    • Allow 24 hours for receptor expression before stimulation

  • Stimulation conditions:

    • Replace transfection media with CD293 media containing appropriate odorant dilutions

    • Prepare 1M odorant stocks in DMSO and create fresh dilutions for each experiment

    • Maintain stimulation period of 4 hours before luminescence measurement

  • Signal detection and normalization:

    • Measure luminescence using a sensitive plate reader (e.g., Polarstar Optima)

    • Normalize all luminescence values by dividing by Renilla Luciferase activity to control for transfection efficiency

    • Include appropriate positive and negative controls on each plate

  • Data analysis refinements:

    • Apply statistical thresholds to identify significant responses

    • Use curve-fitting algorithms to determine EC50 values

    • Implement quality control metrics to identify and exclude outliers

These optimizations ensure sensitive and reproducible detection of OR2B2 activation in response to potential ligands .

How can researchers distinguish between specific OR2B2 activation and non-specific effects?

Distinguishing between specific OR2B2 activation and non-specific effects requires rigorous experimental controls and validation approaches:

  • Vector-only controls: Include cells transfected with empty vector exposed to the same odorant concentrations to identify non-receptor-mediated effects .

  • Statistical validation: Apply the extra sums-of-squares test to confirm that odorant activation of OR2B2 is significantly greater than control responses .

  • Concentration-dependence assessment: Verify that responses follow sigmoidal dose-response relationships with:

    • Non-overlapping 95% confidence intervals between top and bottom parameters

    • Standard deviation of fitted log EC50 less than 1 log unit

  • Receptor specificity panel: Test candidate ligands against a panel of related olfactory receptors to confirm selectivity for OR2B2 .

  • Competitive binding assays: Conduct competition experiments with known ligands to verify binding to the same site.

  • Receptor mutagenesis: Introduce targeted mutations to binding pocket residues to confirm the structural basis of activation.

This comprehensive validation approach ensures that observed responses are genuinely attributable to specific OR2B2 activation rather than artifacts or non-specific effects .

What are the most common challenges in OR2B2 detection assays and how can they be addressed?

Researchers frequently encounter several challenges when working with OR2B2 detection assays:

  • Low signal-to-noise ratio:

    • Solution: Optimize transfection conditions with precise DNA ratios

    • Increase cell density to 15,000-20,000 cells per well

    • Include RTP1S (5 ng/well) to enhance receptor trafficking

  • Inconsistent receptor expression:

    • Solution: Use expression vectors containing Rho tag (first 20 residues of human rhodopsin)

    • Verify clone sequences before experiments

    • Maintain consistent passage numbers for cell lines

  • Cross-reactivity with other receptors:

    • Solution: Include vector-only controls

    • Test against a panel of related receptors

    • Apply stringent statistical criteria to confirm specificity

  • Odorant solubility issues:

    • Solution: Prepare 1M stocks in appropriate solvents (DMSO for hydrophobic, water for hydrophilic)

    • Monitor for precipitation and adjust delivery methods accordingly

    • Use fresh dilutions for each experiment

  • Receptor desensitization:

    • Solution: Optimize stimulation time (typically 4 hours)

    • Implement stepwise concentration increases for dose-response experiments

    • Allow sufficient recovery time between stimulations

Addressing these challenges through systematic optimization improves the reliability and sensitivity of OR2B2 detection assays .

How can researchers validate OR2B2 antibodies for experimental applications?

Validating OR2B2 antibodies for experimental applications requires a comprehensive approach:

  • Western blot validation:

    • Test antibody against recombinant OR2B2 with appropriate tags

    • Include positive controls (overexpressed OR2B2) and negative controls (untransfected cells)

    • Verify expected molecular weight (approximately 35-40 kDa)

    • Confirm specificity by pre-absorption with immunizing peptide

  • Immunocytochemistry validation:

    • Compare staining patterns in cells expressing OR2B2 versus untransfected cells

    • Co-localize with membrane markers to confirm proper trafficking

    • Perform peptide competition assays to demonstrate specificity

    • Use multiple antibodies targeting different epitopes if available

  • ELISA performance assessment:

    • Determine detection range (typically 0.156-10 ng/ml for commercial kits)

    • Evaluate sensitivity with purified recombinant protein standards

    • Test for cross-reactivity with related olfactory receptors

    • Assess reproducibility across different lots

  • Application-specific validation:

    • For each application (Western blot, IHC, ELISA), establish optimal working dilutions

    • Document lot-to-lot variability

    • Verify recognition of both native and recombinant forms, noting potential differences

Thorough validation ensures reliable antibody performance and prevents misleading experimental results when studying OR2B2 .

What statistical approaches are most appropriate for analyzing OR2B2 ligand screening data?

Analysis of OR2B2 ligand screening data requires robust statistical approaches to identify genuine interactions while minimizing false positives:

  • Primary screen analysis:

    • Standardize each plate by setting a reference response (e.g., Olfr544 to nonanedioic acid) to a value of 1

    • Subtract baseline receptor response from the no-odor plate

    • Rank resulting values to identify candidates for secondary screening

    • Select top 5% of odorant/receptor pairs, without exceeding ten ligands per receptor

  • Secondary screen validation:

    • Apply paired statistical tests to compare odor responses to no-odor controls

    • Implement multiple concentration testing (1, 10, and 100 μM) to identify concentration-dependent effects

    • Use triplicate measurements to ensure reproducibility

    • Establish clear criteria for advancement to dose-response testing

  • Dose-response curve analysis:

    • Fit data to sigmoidal curves using nonlinear regression

    • Calculate EC50 values with 95% confidence intervals

    • Apply extra sums-of-squares F-test to confirm significant activation compared to vector-only controls

    • Ensure standard deviation of fitted log EC50 is less than 1 log unit

  • Multi-receptor comparison:

    • Use ANOVA with post-hoc tests for comparing responses across multiple receptors

    • Apply Hill function fitting to compare receptor sensitivities:
      R=RmaxCnCn+EC50nR = R_{max} \cdot \frac{C^n}{C^n + \text{EC}_{50}^n}

    • Compare EC50 values between receptors using sum-of-squares F test

These statistical approaches ensure rigorous identification and characterization of OR2B2 ligands with minimized false positives and negatives .

How can researchers effectively compare OR2B2 responses across different experimental systems?

Comparing OR2B2 responses across different experimental systems requires standardization and normalization approaches:

  • Internal reference standardization:

    • Include a standard receptor-ligand pair in all experiments (e.g., Olfr544 with nonanedioic acid)

    • Set the response of this standard to a defined value (typically 1.0)

    • Express all other responses relative to this standard

  • Assay-specific normalization:

    • For luciferase assays: normalize to Renilla luciferase activity to control for transfection efficiency

    • For calcium imaging: normalize to ionomycin response

    • For cAMP assays: include forskolin controls for system calibration

  • Data transformation approaches:

    • Calculate fold-change relative to baseline for each system

    • Transform raw data to percent of maximum response

    • Apply Z-score normalization to account for different baseline variabilities

  • Comparative analysis framework:

    • Create standardized response matrices across receptors and ligands

    • Develop receptor response profiles that can be compared across systems

    • Use principal component analysis to identify response patterns independent of absolute magnitudes

  • Meta-analysis considerations:

    • Account for methodological differences when comparing across studies

    • Weight data based on sample size and technical variability

    • Identify consistent response patterns rather than absolute values

These approaches enable meaningful comparison of OR2B2 responses across different experimental platforms and studies, facilitating integration of results from diverse research groups .

What emerging technologies hold promise for advancing OR2B2 research?

Several cutting-edge technologies are poised to transform OR2B2 research in the coming years:

  • CRISPR-based screening approaches:

    • Generation of OR2B2 knockout models for functional validation

    • High-throughput mutagenesis to identify critical binding residues

    • Creation of reporter lines with endogenous OR2B2 tagging

  • Advanced structural biology techniques:

    • Cryo-EM determination of OR2B2 structure in complex with ligands

    • Molecular dynamics simulations of ligand-receptor interactions

    • Structure-guided design of highly selective OR2B2 modulators

  • Single-cell transcriptomics and proteomics:

    • Characterization of OR2B2 expression patterns across olfactory neuron populations

    • Identification of receptor-specific signaling components

    • Mapping of receptor-specific neuronal circuits

  • Microfluidic-based odorant delivery systems:

    • Precise spatiotemporal control of odorant concentrations

    • Multiplexed screening of odorant mixtures

    • Real-time measurement of receptor activation kinetics

  • In vivo imaging techniques:

    • Genetically encoded sensors for OR2B2 activation

    • Two-photon imaging of OR2B2-expressing neurons in live animals

    • Correlation of receptor activation with behavioral responses

These emerging technologies will enable unprecedented insights into OR2B2 structure, function, and physiological relevance, potentially leading to novel applications in sensory neuroscience and drug discovery.

How can computational approaches enhance OR2B2 ligand discovery and characterization?

Computational approaches offer powerful tools to accelerate OR2B2 research through several strategies:

  • Homology modeling and virtual screening:

    • Develop refined OR2B2 structural models based on related GPCRs

    • Perform virtual screening of large compound libraries to identify potential ligands

    • Prioritize candidates based on predicted binding energies and interactions

  • Machine learning applications:

    • Train models on existing olfactory receptor-ligand data to predict new interactions

    • Identify chemical features correlated with OR2B2 activation

    • Develop quantitative structure-activity relationship (QSAR) models specific to OR2B2

  • Systems biology integration:

    • Model the olfactory signaling cascade downstream of OR2B2

    • Predict cross-talk between OR2B2 and other receptors

    • Integrate receptor activation data with neuronal network models

  • Pharmacophore modeling:

    • Identify key structural features required for OR2B2 activation

    • Design novel ligands based on pharmacophore hypotheses

    • Optimize lead compounds for improved potency and selectivity

  • Network analysis approaches:

    • Map relationships between odorants based on receptor activation profiles

    • Identify structural determinants of receptor tuning

    • Predict odor perception based on receptor activation patterns

These computational approaches can significantly accelerate the discovery and optimization of OR2B2 ligands while reducing the resources required for experimental screening .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.