Recombinant Human Olfactory receptor 2D2 (OR2D2)

Shipped with Ice Packs
In Stock

Description

Research Applications and Potential

While direct studies on OR2D2 remain limited, its recombinant form enables investigations into:

Ligand Binding and Olfactory Coding

OR2D2’s binding pocket is hypothesized to interact with small hydrophobic odorants, similar to structurally characterized receptors like OR51E2 (which binds short-chain fatty acids) . Computational models suggest OR2D2 may recognize ligands through:

  • Hydrophobic interactions in transmembrane regions (TM3, TM5, TM6).

  • Polar interactions (e.g., hydrogen bonds) in ECL2 or ECL3.

Functional Assays

Recombinant OR2D2 is used in:

  • Electrophysiology: Measuring odorant-induced ion flux or cAMP signaling.

  • Bioassays: Identifying agonists/antagonists for drug development or olfactory modulation .

Table 1: Sequence Features of OR2D2

RegionKey Residues/Features
N-TerminalMRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY...
TM DomainsHydrophobic residues (e.g., Leu, Val, Ile) in TM1-TM7 for membrane anchoring.
ECLsPolar residues for ligand binding (e.g., Asp, Gln, Thr in ECL2/ECL3).
C-TerminalICL3 motifs for G-protein coupling (e.g., Arg, Lys in intracellular loops).

Full sequence: MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMYFFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSYDRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCEAPALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFSTCGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR KVATRNFP .

Challenges and Future Directions

  1. Limited Functional Data: No published studies explicitly link OR2D2 to specific odorants.

  2. Structural Gaps: Cryo-EM or X-ray crystallography data are absent, unlike OR51E2 .

  3. Database Integration: OR2D2 is not listed in the M2OR database of OR-molecule pairs .

Future research should prioritize:

  • Deorphanization: Identifying ligands via high-throughput screening.

  • Structural Characterization: Resolving OR2D2’s 3D structure to guide ligand design.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2D2; OR2D1; Olfactory receptor 2D2; HB2; Olfactory receptor 11-610; OR11-610; Olfactory receptor 2D1; Olfactory receptor OR11-88
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2D2
Target Protein Sequence
MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY FFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSY DRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCE APALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFST CGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR KVATRNFP
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8244

OMIM: 608494

KEGG: hsa:120776

STRING: 9606.ENSP00000299459

UniGene: Hs.690210

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Human Olfactory Receptor 2D2?

Human Olfactory Receptor 2D2 (OR2D2) is a member of the G protein-coupled receptor (GPCR) family that participates in olfactory signal transduction. Like other olfactory receptors, OR2D2 contains seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. The receptor is primarily expressed in olfactory sensory neurons (OSNs) located in the olfactory epithelium.

Functionally, OR2D2 transduces odor detection through the canonical olfactory signaling pathway. When an odorant binds to OR2D2, it activates the olfactory-specific G protein (GNAL/Gαolf), which subsequently stimulates adenylyl cyclase to increase intracellular cAMP levels. This leads to the opening of cyclic nucleotide-gated (CNG) channels, resulting in calcium influx and membrane depolarization, ultimately generating action potentials that are transmitted to the olfactory bulb .

How can I express recombinant OR2D2 in heterologous cell systems?

Expressing functional olfactory receptors in heterologous systems presents significant challenges due to poor trafficking to the cell surface. For OR2D2 expression, the most effective approach utilizes human embryonic kidney-derived HEK293 cells (specifically Hana3A cells) co-transfected with chaperone proteins that enhance receptor trafficking.

The recommended protocol includes:

  • Vector construction: Clone the OR2D2 coding sequence into an expression vector containing an N-terminal tag such as the Rho-tag (rhodopsin-derived signal peptide), Lucy-tag, or IL-6-Halo-tag to improve surface expression .

  • Co-transfection with trafficking enhancers: Include plasmids encoding:

    • Receptor-transporting proteins (RTP1S, RTP2)

    • Receptor expression-enhancing protein 1 (REEP1)

    • Olfactory-specific G protein (GNAL/Gαolf)

    • G protein chaperone Ric-8B

  • Additional enhancement: Co-express non-OR GPCRs (e.g., β2-adrenergic receptor or M3 muscarinic acetylcholine receptor) to form heterodimers with OR2D2, which improves sorting to the cell surface and suppresses β-arrestin 2-mediated receptor internalization .

This approach significantly increases the likelihood of obtaining functional OR2D2 expression suitable for downstream assays.

What methods can be used to verify OR2D2 expression and localization?

Verifying OR2D2 expression and localization requires multiple complementary approaches:

  • Transcript verification: Use RT-PCR or RNA-Seq to confirm OR2D2 mRNA expression. Design primers that specifically target OR2D2 to avoid cross-reactivity with other olfactory receptors .

  • Protein detection methods:

    • Western blot analysis using antibodies against OR2D2 or the N-terminal tag

    • Immunofluorescence microscopy to visualize receptor localization

    • Flow cytometry to quantify surface expression levels

  • Subcellular localization:

    • Membrane fractionation followed by Western blotting

    • Confocal microscopy using dual staining with membrane markers (e.g., acetylated-tubulin for cilia) and OR2D2 antibodies or tag-specific antibodies

For immunofluorescence studies, it's critical to validate antibody specificity using appropriate controls, such as OR2D2 knockout samples or competing peptide controls, similar to the validation performed for other olfactory receptors .

What are the most effective functional assays for characterizing OR2D2 ligand interactions?

Functional characterization of OR2D2-ligand interactions requires sensitive assays that can detect receptor activation in real-time. Based on current methodologies for olfactory receptors, the following approaches are recommended:

  • Real-time calcium imaging assays:

    • Load OR2D2-expressing cells with calcium-sensitive dyes (e.g., Fura-2 AM)

    • Monitor intracellular Ca²⁺ influx in real-time after odorant stimulation

    • This approach is preferred over endpoint cAMP measurements as it captures the immediate physiological response and avoids issues with odorant degradation during prolonged exposure

  • Luciferase-based cAMP detection:

    • Co-express GloSensor™ (a highly sensitive luciferase for cAMP detection) with OR2D2

    • Measure luminescence changes upon receptor activation

    • This provides a quantitative readout of receptor activation

  • Electrophysiological recordings:

    • Patch-clamp recordings from OR2D2-expressing cells

    • Extracellular field potential recordings using microelectrode arrays

    • Ex vivo electroolfactogram (EOG) recordings from isolated olfactory tissues expressing OR2D2

Assay TypeTemporal ResolutionSensitivityThroughputSpecial Considerations
Calcium ImagingHigh (seconds)Medium-HighMediumMost physiologically relevant
Luciferase-cAMPMedium (minutes)HighHighBest for screening applications
EOG RecordingsHigh (milliseconds)HighLowClosest to in vivo response

When designing these assays, consider that olfactory receptors typically show rapid adaptation and desensitization, so short-duration stimuli with sufficient recovery periods are essential for accurate characterization .

How do I overcome challenges in identifying specific ligands for OR2D2?

Identifying specific ligands for OR2D2 presents several challenges. A systematic approach should include:

  • Computational screening and docking:

    • Use homology modeling of OR2D2 based on known GPCR structures

    • Perform virtual screening of odorant libraries against the binding pocket model

    • Prioritize compounds based on predicted binding energies and interactions

  • High-throughput screening strategy:

    • Create a stable cell line expressing OR2D2 with optimal trafficking enhancers

    • Screen diverse odorant libraries starting with chemical classes known to activate similar olfactory receptors

    • Use odor molecule libraries that cover different chemical structures (aldehydes, alcohols, esters, etc.)

    • Implement concentration-response curves for candidate ligands (typical concentration range: 1 nM to 100 μM)

  • Validation of hits:

    • Confirm specificity by testing identified ligands against cells expressing other olfactory receptors

    • Use structure-activity relationship studies to identify the pharmacophore

    • Verify responses with antagonists or by using siRNA knockdown approaches

  • Improving sensitivity:

    • Suppress inhibitory mechanisms by incorporating PDE (phosphodiesterase) inhibitors

    • Use OBPs (odorant binding proteins) to enhance odorant presentation to OR2D2

    • Incorporate OMPs (olfactory marker proteins) to increase intracellular cAMP levels

    • Consider GRK2 (G-protein-coupled receptor kinase 2) inhibitors to suppress β-arrestin binding and receptor internalization

This methodical approach increases the likelihood of identifying specific OR2D2 ligands while minimizing false positives.

What mechanisms regulate OR2D2 sensitivity and adaptation?

OR2D2, like other olfactory receptors, likely undergoes complex regulation affecting its sensitivity and adaptation. Based on research on similar olfactory receptors:

  • Receptor desensitization mechanisms:

    • GRK-mediated phosphorylation followed by β-arrestin recruitment

    • Receptor internalization via clathrin-dependent endocytosis

    • Modulation by second messenger-dependent kinases (PKA, PKC)

  • Signal termination pathways:

    • cAMP degradation by phosphodiesterases

    • Ca²⁺ extrusion via Na⁺/Ca²⁺ exchangers (NCX) and plasma membrane calcium pumps (PMCA)

    • Negative feedback through Ca²⁺-calmodulin-dependent protein kinase II (CaMKII)

  • Potential neuromodulatory regulation:

    • Similar to DRD2 regulation of other olfactory receptors, OR2D2 sensitivity may be modulated by neurotransmitters or neuropeptides

    • Dopamine may act through inhibitory G proteins (Gαi/o) to counteract the stimulatory Gαolf pathway, reducing cAMP generation in response to odors

    • Local synthesis of neuromodulators in the olfactory mucosa may change in different physiological states (e.g., hunger)

To study these mechanisms, researchers can use:

  • Phosphorylation-specific antibodies

  • Fluorescently tagged β-arrestin to monitor recruitment

  • FRET-based assays to study protein-protein interactions

  • Pharmacological inhibitors of specific regulatory components

The complex interplay between these mechanisms determines the sensitivity, adaptation, and signal-to-noise ratio of OR2D2-mediated olfactory signaling.

How can OR2D2 be incorporated into biosensor applications?

Developing biosensors based on OR2D2 requires effective strategies for receptor expression, signal amplification, and detection systems:

  • Cell-based biosensor platforms:

    • Stable cell lines expressing OR2D2 with optimal trafficking enhancers

    • Immobilized cells in microfluidic devices for continuous monitoring

    • Reporter systems that translate receptor activation into measurable signals (fluorescence, electrical, etc.)

  • Cell-free biosensor approaches:

    • Nanodisc or liposome-reconstituted OR2D2

    • Receptor-functionalized field-effect transistors (Bio-FETs)

    • Surface plasmon resonance (SPR) with immobilized receptors

  • Signal amplification and detection optimization:

    • Suppress inhibitory mechanisms (PDE inhibitors, CaMKII inhibitors)

    • Incorporate signal amplification components (e.g., optimized G protein subunits)

    • Use real-time detection systems for immediate response measurement

When developing these biosensors, consider that the detection threshold for human OR-based sensors is typically higher than human olfactory perception. To address this limitation, incorporate the optimizations mentioned in sections 2.1 and 2.2, which can significantly improve sensitivity .

What are the current contradictions in OR2D2 research data and how might they be resolved?

Several contradictions may exist in OR2D2 research, similar to those observed with other olfactory receptors:

  • Expression pattern discrepancies:

    • Different studies may report varying tissue expression patterns

    • Resolution approach: Apply single-cell RNA sequencing across multiple tissue samples with appropriate controls, similar to the approach used for DRD2 expression analysis in olfactory tissues

  • Ligand specificity contradictions:

    • Variations in reported ligand specificity between labs using different expression systems

    • Resolution approach: Standardize expression systems and assay conditions across laboratories; compare results using multiple detection methods (calcium imaging, cAMP assays, and electrophysiology)

  • Functional role discrepancies:

    • Conflicting reports on the role of OR2D2 in specific olfactory processes

    • Resolution approach: Generate targeted OR2D2 knockout models and perform comprehensive olfactory phenotyping, similar to conditional knockout approaches used for studying DRD2 function

To resolve these contradictions, researchers should:

  • Implement rigorous controls for antibody specificity (e.g., using knockout tissues)

  • Utilize multiple complementary techniques to verify findings

  • Consider the impact of receptor trafficking enhancers on functional studies

  • Account for potential heterodimer formation with other GPCRs that may alter receptor properties

What genetic approaches can be used to study OR2D2 function in vivo?

Genetic approaches provide powerful tools for studying OR2D2 function in physiological contexts:

  • Conditional gene targeting strategies:

    • Generate OR2D2 conditional knockout mice using Cre-lox system

    • Use olfactory-specific promoters (e.g., OMP-Cre) to restrict deletion to mature olfactory sensory neurons

    • Create knockin reporter lines (e.g., OR2D2-GFP) to visualize expressing neurons

  • CRISPR/Cas9-based approaches:

    • Generate precise point mutations to study structure-function relationships

    • Develop inducible knockout systems for temporal control of gene deletion

    • Create epitope-tagged versions of endogenous OR2D2 for localization studies

  • Functional validation methods:

    • Behavioral assays (buried food finding test, olfactory sensitivity test)

    • Ex vivo electrophysiological recordings (EOG) from the olfactory epithelium

    • In vivo calcium imaging of OR2D2-expressing neurons

  • siRNA-based approaches:

    • Design specific siRNA sequences targeting OR2D2 (similar to the approach used for OR51E2)

    • Deliver using viral vectors or electroporation

    • Validate knockdown efficiency at both transcript and protein levels

Experimental design should include appropriate controls:

  • Use of littermate controls to minimize genetic background effects

  • Inclusion of scrambled siRNA sequences as negative controls

  • Validation of gene targeting specificity using RT-PCR and immunostaining

These genetic approaches provide complementary insights into OR2D2 function across multiple levels of analysis from molecular mechanisms to behavioral outputs.

How can single-cell technologies advance our understanding of OR2D2 biology?

Single-cell technologies offer unprecedented opportunities to dissect OR2D2 biology within the complex cellular landscape of the olfactory system:

  • Single-cell RNA sequencing applications:

    • Characterize the complete transcriptome of OR2D2-expressing neurons

    • Identify co-expressed genes that may modify receptor function

    • Discover cell type-specific expression patterns across different tissues

    • Map developmental trajectories of OR2D2-expressing cells

  • Single-cell proteomics approaches:

    • Analyze the protein interactome of OR2D2 in individual cells

    • Identify post-translational modifications that regulate receptor function

    • Quantify receptor expression levels across different cell populations

  • Functional genomics at single-cell resolution:

    • Combine CRISPR screens with single-cell readouts to identify regulators of OR2D2

    • Use patch-seq to correlate transcriptional profiles with electrophysiological properties

    • Apply spatial transcriptomics to map OR2D2-expressing cells within the olfactory epithelium

Single-cell data analysis requires sophisticated computational approaches:

  • Dimensionality reduction techniques (t-SNE, UMAP)

  • Trajectory inference methods to map developmental or state transitions

  • Integration of multi-omics data to build comprehensive models of OR2D2 regulation

These approaches can reveal heterogeneity among OR2D2-expressing cells and provide insights into cell-specific regulatory mechanisms that are masked in bulk analyses.

What are the methodological considerations for studying OR2D2 interactions with intracellular signaling pathways?

Investigating OR2D2 interactions with intracellular signaling pathways requires careful methodological considerations:

  • Protein-protein interaction studies:

    • Proximity ligation assays to detect interactions in situ

    • Co-immunoprecipitation with epitope-tagged OR2D2

    • FRET or BRET approaches to study dynamic interactions in living cells

    • Split-protein complementation assays for high-throughput interaction screening

  • G protein coupling specificity:

    • BRET-based G protein activation assays

    • [³⁵S]GTPγS binding assays to measure G protein activation

    • Analysis of second messenger production using biosensors (cAMP, Ca²⁺, DAG)

    • Compare OR2D2 coupling to Gαolf versus other G proteins (Gαi/o, Gαq)

  • Downstream signaling pathway analysis:

    • Phosphoproteomic analysis following receptor activation

    • Real-time monitoring of PKA activity using FRET-based reporters

    • CREB phosphorylation assays as readouts of transcriptional activation

    • Examination of cross-talk with other signaling pathways

Signaling ComponentFunctionDetection MethodConsiderations
GαolfPrimary G protein couplingBRET, [³⁵S]GTPγS bindingRequires specific antibodies
Adenylyl cyclase (type III)cAMP productionGloSensor™, FRET biosensorsFast temporal dynamics
PKAPhosphorylation of targetsPhospho-specific antibodies, FRET sensorsCompartmentalized signaling
CNG channelsCa²⁺ influxCa²⁺ imaging, electrophysiologyFast kinetics, desensitization
CREBTranscriptional regulationLuciferase reporters, ChIP-seqDelayed response

When designing these experiments, control for potential artifacts introduced by trafficking enhancers or epitope tags that may alter signaling properties.

How can computational approaches enhance OR2D2 ligand discovery and characterization?

Computational approaches offer powerful tools to accelerate OR2D2 ligand discovery and characterization:

  • Structure-based methods:

    • Homology modeling of OR2D2 based on recently solved GPCR structures

    • Molecular dynamics simulations to study binding pocket dynamics

    • Virtual screening of chemical libraries against the OR2D2 model

    • QM/MM methods to understand the energetics of ligand-receptor interactions

  • Machine learning approaches:

    • Develop predictive models for OR2D2 ligands based on physicochemical properties

    • Use deep learning to identify structural features that determine binding affinity

    • Apply transfer learning from related olfactory receptors to improve predictions

    • Implement active learning strategies to guide experimental testing of compounds

  • Systems biology integration:

    • Network analysis of OR2D2 in the context of the complete olfactory receptor repertoire

    • Modeling of signal integration from multiple olfactory receptors

    • Simulation of adaptation and sensitivity regulation mechanisms

    • Prediction of complex odor perception based on receptor activation patterns

To validate computational predictions:

  • Test top virtual screening hits in functional assays

  • Perform site-directed mutagenesis of predicted binding residues

  • Use structure-activity relationships to refine binding models

  • Iterate between computational prediction and experimental validation

These computational approaches can significantly reduce the experimental burden of screening large chemical libraries and provide mechanistic insights into OR2D2-ligand interactions that are difficult to obtain experimentally.

What are the emerging research directions for OR2D2 and related olfactory receptors?

Research on OR2D2 and related olfactory receptors is evolving rapidly, with several promising directions:

  • Integrative multi-omics approaches:

    • Combining genomics, transcriptomics, proteomics, and metabolomics to build comprehensive models of olfactory receptor function

    • Single-cell multi-omics to understand cellular heterogeneity and specialization

    • Spatial transcriptomics to map the distribution and organization of OR2D2-expressing neurons

  • Advanced biosensor development:

    • Cell-free receptor-based biosensors for environmental monitoring

    • Wearable devices incorporating OR2D2-based sensors for medical diagnostics

    • Hybrid biological-electronic interfaces for odor detection and classification

  • Therapeutic applications:

    • Targeting OR2D2 for olfactory dysfunction treatment

    • Developing antagonists or allosteric modulators to modify olfactory perception

    • Exploring ectopic OR2D2 expression in non-olfactory tissues for diagnostic purposes

  • Fundamental mechanisms:

    • Understanding the molecular basis of olfactory coding and discrimination

    • Elucidating the mechanisms of olfactory adaptation and sensitivity regulation

    • Investigating the role of olfactory receptors in non-canonical signaling pathways

These emerging directions will benefit from technological advances in structural biology, single-cell analysis, and computational methods, driving significant progress in our understanding of OR2D2 biology and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.