Recombinant Human Olfactory receptor 2F1 (OR2F1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its inclusion in the manufacturing process.
Synonyms
OR2F1; OLF3; OR2F3; OR2F3P; OR2F4; OR2F5; Olfactory receptor 2F1; Olfactory receptor 2F3; Olfactory receptor 2F4; Olfactory receptor 2F5; Olfactory receptor-like protein OLF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2F1
Target Protein Sequence
MGTDNQTWVSEFILLGLSSDWDTRVSLFVLFLVMYVVTVLGNCLIVLLIRLDSRLHTPMY FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY DRYVAVCDALRYSAIMHGGLCARLAITSWVSGFISSPVQTAITFQLPMCRNKFIDHISCE LLAVVRLACVDTSSNEVTIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSREGRKKAFHT CASHLTVVALCYGVAIFTYIQPHSSPSVLQEKLFSVFYAILTPMLNPMIYSLRNKEVKGA WQKLLWKFSGLTSKLAT
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8246

OMIM: 608497

KEGG: hsa:26211

STRING: 9606.ENSP00000376633

UniGene: Hs.553595

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory Receptor 2F1 (OR2F1) and how does it function in the olfactory system?

Human Olfactory Receptor 2F1 (OR2F1) is a G-protein coupled receptor (GPCR) belonging to the largest family of olfactory receptors. It functions within the combinatorial coding system where odorants are recognized according to a pattern: a single molecule can activate multiple receptors, and each receptor can respond to several different molecules . OR2F1, like other olfactory receptors, is expressed in olfactory sensory neurons and plays a critical role in the initial molecular recognition events of olfaction. When an odorant binds to OR2F1, it triggers a signaling cascade that ultimately leads to odor perception.

What challenges do researchers face when studying OR2F1 compared to other proteins?

Studying OR2F1 presents several unique challenges:

  • Membrane protein complexity: As a membrane protein, OR2F1 requires specific environments to maintain its native conformation and functionality.

  • Expression difficulties: OR2F1, like many olfactory receptors, often expresses poorly in heterologous systems due to trafficking issues and protein misfolding.

  • Functional assay limitations: Determining the molecular recognition spectrum of OR2F1 requires specialized bioassays that can detect subtle signaling changes.

  • Combinatorial code complexity: Understanding how OR2F1 contributes to the broader olfactory code requires comprehensive studies of numerous receptor-odorant interactions .

  • Structural constraints: Obtaining structural information on OR2F1 is challenging due to difficulties in crystallizing membrane proteins.

How do researchers identify and classify OR2F1 in genomic and proteomic studies?

In the field of olfactory research, standardized identification systems are essential. For OR2F1 and other olfactory receptors, researchers typically use:

  • Protein sequence as identifier: The amino acid sequence serves as the standard identifier in databases like M2OR .

  • Multiple identification markers: OR2F1 can be referenced using gene name, UniProt ID, protein sequence, mutation information (if applicable), and species of origin .

  • Taxonomic classification: The species from which OR2F1 originates (human, in this case) is specified to distinguish it from homologous receptors in other species .

  • Mutation notation: For mutated receptor studies, researchers use the format XpositionY, where amino acid X from the wild-type sequence is mutated to amino acid Y at the given position .

What expression systems are most effective for producing functional recombinant OR2F1?

Several expression systems have been developed for OR2F1, each with distinct advantages:

  • Mammalian cell systems: HEK-293 cells provide a eukaryotic environment suitable for proper folding and post-translational modifications of OR2F1 .

  • Cell-free protein synthesis (CFPS): This system offers rapid production of OR2F1 without cellular constraints, though potentially with lower yields compared to cellular systems .

  • Wheat germ expression systems: These can be used for initial studies but may lack mammalian-specific folding mechanisms .

The choice depends on research goals:

  • For functional studies: Mammalian systems are preferred

  • For structural studies: Cell-free systems with nanodiscs may offer advantages

  • For high-throughput screening: HEK293 or specialized Hana3A cells (engineered specifically for olfactory receptor expression) are often optimal

How do different tags affect OR2F1 expression, purification, and functionality?

Tag selection significantly impacts OR2F1 research outcomes:

  • GST tag: Useful for affinity purification but may impact receptor function due to its size .

  • His tag: Provides efficient purification while minimally affecting protein structure; suitable for applications requiring high purity .

  • Strep tag: Offers gentle elution conditions that help maintain OR2F1 in its native conformation .

  • Rho tag and other N-terminal modifications: These can enhance surface expression of OR2F1 in heterologous systems .

When selecting a tag, researchers should consider:

  • The intended experimental application

  • Required purity level

  • Potential interference with ligand binding

  • Whether the tag needs to be removed post-purification

What methodological approaches optimize OR2F1 trafficking to the cell membrane in heterologous systems?

Successful OR2F1 expression often requires specialized approaches:

  • Co-expression with chaperone proteins: RTP1 and RTP2 (Receptor Transporting Proteins) significantly enhance OR2F1 surface expression .

  • Specialized cell lines: Hana3A cells, which express chaperon proteins and olfactory G-proteins, show 41% success in bioassays for olfactory receptors .

  • N-terminal modifications: Addition of leader sequences or tags like rho-tag can improve trafficking .

  • G-protein co-expression: Co-transfection with appropriate G-proteins enhances signaling capabilities .

This methodological approach has been validated across multiple olfactory receptors and represents a crucial consideration for OR2F1 studies.

How do synthetic nanodiscs improve OR2F1 research compared to traditional approaches?

Synthetic nanodiscs offer several significant advantages for OR2F1 studies:

  • Native-like membrane environment: Nanodiscs provide a phospholipid bilayer that mimics the natural environment of OR2F1, maintaining its proper conformation and functionality .

  • Increased stability: OR2F1 in nanodiscs shows higher stability compared to detergent-solubilized preparations .

  • Enhanced solubility: The nanodisc structure keeps OR2F1 soluble in aqueous solutions without detergents .

  • Compatibility with cell-based assays: Unlike detergent-solubilized preparations, nanodisc-embedded OR2F1 can be used in cell-based functional assays .

  • Direct preparation from cells: Unlike traditional membrane scaffold protein (MSP) nanodiscs, synthetic nanodiscs can be prepared directly from cells, simplifying the workflow .

What is the methodological process for incorporating OR2F1 into synthetic nanodiscs?

The preparation of OR2F1-containing synthetic nanodiscs follows a distinct methodology:

  • Membrane solubilization: Polymers with dual function are used to dissolve cell membranes containing OR2F1 .

  • Nanodisc formation: These same polymers facilitate nanodisc formation around OR2F1 using cellular phospholipids .

  • Purification: OR2F1-embedded nanodiscs are then purified using appropriate affinity tags .

  • Characterization: Quality assessment using methods such as SDS-PAGE, Western Blot, and analytical SEC (HPLC) ensures proper incorporation .

  • Lyophilization: For storage, the preparations are typically lyophilized from nanodisc solubilization buffer (20 mM Tris-HCl, 150 mM NaCl, pH 8.0) with 5-8% trehalose added as a protectant .

This methodology yields highly purified OR2F1 in a native-like membrane environment, suitable for various functional and structural studies.

What buffer conditions and storage parameters optimize OR2F1 stability in synthetic nanodiscs?

Optimizing buffer conditions is critical for maintaining OR2F1 functionality in nanodiscs:

  • Buffer composition: 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 provides optimal stability for OR2F1-containing nanodiscs .

  • Lyophilization with protectants: Addition of 5-8% trehalose protects OR2F1 during lyophilization .

  • Storage temperature: Lyophilized OR2F1 nanodiscs should be stored at -20°C or preferably -80°C for long-term stability .

  • Reconstitution considerations: Care must be taken during reconstitution to maintain nanodisc integrity and OR2F1 functionality.

  • Stability limitations: Synthetic nanodiscs containing OR2F1 are intolerant to acids and high concentrations of divalent metal ions .

These parameters have been empirically determined to maintain OR2F1 in its most stable and functional state for research applications.

What bioassay approaches are most effective for studying OR2F1-ligand interactions?

Several bioassay methodologies can be employed for OR2F1 functional studies:

  • Luciferase reporter assays: Particularly using Hana3A cell lines, these assays measure downstream signaling events after OR2F1 activation .

  • Calcium imaging: Measures intracellular calcium fluxes in response to OR2F1 activation .

  • cAMP assays: Quantify changes in cAMP levels following OR2F1 stimulation .

  • SEAP (Secreted embryonic alkaline phosphatase) assays: An alternative reporter system for OR2F1 activation .

  • GFP fluorescence measurements: Can be used to detect conformational changes or downstream signaling .

  • Electrophysiological measurements: Direct recording of membrane activity measured by intensity or conductance .

The choice of assay should consider sensitivity requirements, time constraints, and the specific signaling pathway coupled to OR2F1.

How should concentration-dependent responses of OR2F1 be experimentally designed and analyzed?

Concentration-response studies for OR2F1 require careful methodological consideration:

  • Concentration range: Olfactory perception and OR activation are highly concentration-dependent; a molecule may not induce response at low concentration but become an agonist at higher concentrations .

  • Experimental design: Studies should test multiple concentrations to determine EC50 values (the concentration at which 50% of maximal response is achieved) .

  • Screening concentration: Initial screening should use standardized concentrations, then follow up with full dose-response curves for hits .

  • Data analysis: Dose-response data should be fitted to appropriate models (typically sigmoidal) to extract EC50 and efficacy parameters.

  • Interpretation considerations: Odorant concentration can influence not just response magnitude but also perceived odor quality .

This methodological approach acknowledges that concentration is a critical variable in OR2F1 studies, not merely an experimental parameter.

How can researchers distinguish between specific and non-specific interactions with OR2F1?

Differentiating true OR2F1 ligands from false positives requires rigorous methodology:

  • Multiple assay validation: Test potential ligands in different assay systems, as some ORs show assay-dependent bias .

  • Cell line comparison: New ligands may be identified in certain cell lines (e.g., LNCaP) but not recognized when ORs are expressed in others (e.g., HEK293) .

  • Control receptors: Include structurally related and unrelated ORs to confirm specificity.

  • Concentration-response relationships: True ligands typically show dose-dependent effects with saturable binding.

  • Competitive binding studies: Competition with known ligands can help confirm binding site specificity.

This multifaceted approach addresses the challenge that assay-dependent bias can significantly impact OR2F1 ligand identification .

How can researchers integrate OR2F1 functional data into the broader understanding of the olfactory code?

Interpreting OR2F1 data within the context of the combinatorial olfactory code requires:

  • Comparative analysis: Compare OR2F1 response patterns with other ORs to understand its unique contribution to the code .

  • Non-responsive data inclusion: Both responsive and non-responsive OR2F1-molecule pairs should be analyzed, as the absence of response is an integral part of the combinatorial code .

  • Database integration: Utilize comprehensive databases like M2OR to place OR2F1 findings in context with other OR-molecule interactions .

  • Stereochemical considerations: Analyze OR2F1 responses to stereoisomers, as certain ORs (e.g., OR1A1) respond differently to enantiomers .

  • Concentration-dependent coding: Incorporate how OR2F1 response patterns change across concentration ranges .

This integrated approach acknowledges that understanding a single receptor like OR2F1 requires contextualizing its function within the broader olfactory system.

What resources and databases are most valuable for OR2F1 research?

Several resources support OR2F1 and broader olfactory receptor research:

  • M2OR Database: The most comprehensive database of OR-molecule experiments with 51,395 unique pairs and 75,050 different experiments . It includes:

    • Experimental details and bioassay information

    • Both responsive and non-responsive pairs

    • Concentration data and stereochemistry properties

    • Protein sequences and detailed experimental procedures

  • Comparison with other databases:

DatabaseOR-Molecule PairsMoleculesORsSpeciesNon-responsive pairsBioassay description
OdorDB4029581227NoNo
ODORactor4223300016082NoNo
OlfactionDB40085832NoNo
Cong et al.15,6932447202YesNo
OlfactionBase8743301502NoNo
M2OR51,3957681,24611YesYes

This table demonstrates M2OR's superior comprehensiveness for olfactory receptor research including OR2F1 studies .

How can contradictory findings about OR2F1 ligands be reconciled methodologically?

Resolving contradictory OR2F1 results requires systematic methodological approaches:

  • Assay system comparison: Different assay systems may produce contradictory results for the same OR2F1-ligand pair due to assay-dependent bias .

  • Cell line effects: Results may differ when OR2F1 is expressed in different cell types (e.g., HEK293 vs. LNCaP) .

  • Experimental detail analysis: Compare bioassay metadata including:

    • Cell line used for expression

    • Type of G-protein co-expressed

    • Co-transfected accessory proteins

    • N-terminal modifications or tags

    • Delivery method and assay system

  • Concentration reconciliation: Apparent contradictions may result from different concentration ranges tested .

  • Meta-analysis approach: Integrate findings across multiple studies, weighted by methodological rigor.

This systematic approach acknowledges that contradictions often arise from methodological differences rather than actual biological variability.

How can machine learning approaches enhance OR2F1 ligand prediction and functional understanding?

Machine learning offers powerful methodologies for OR2F1 research:

  • Training data preparation: The M2OR database provides extensive data suitable for machine learning approaches, with its comprehensive compilation of 75,050 bioassay experiments .

  • Assay metadata utilization: Information such as cell line, concentration, and assay type from M2OR can be used to estimate response confidence levels for model training .

  • Feature engineering: Molecular descriptors and OR2F1 sequence features can be combined to predict binding and activation.

  • Model selection considerations: Different models (random forests, neural networks, etc.) may be appropriate depending on data characteristics and research goals.

  • Validation approaches: Cross-validation and external test sets should be used to assess model reliability.

This methodological framework leverages the rich dataset available through M2OR and similar resources to develop predictive models for OR2F1 function .

What experimental approaches can determine structure-function relationships in OR2F1?

Investigating OR2F1 structure-function relationships requires sophisticated methodologies:

  • Mutagenesis studies: Site-directed mutagenesis can identify critical residues for ligand binding and receptor activation.

  • Chimeric receptor construction: Creating chimeras between OR2F1 and related receptors can locate domains responsible for specific functions.

  • Homology modeling: Computational models based on related GPCR structures can predict OR2F1 binding sites.

  • Molecular dynamics simulations: These can provide insights into conformational changes during OR2F1 activation.

  • Biophysical characterization: Techniques like circular dichroism, fluorescence spectroscopy, and NMR can probe structural features of OR2F1 in nanodiscs .

This multifaceted approach can reveal how OR2F1's structure determines its function within the olfactory system.

What interdisciplinary approaches might advance understanding of OR2F1's role in the olfactory system?

Future OR2F1 research will benefit from interdisciplinary methodologies:

  • Systems biology approaches: Integrating OR2F1 data into network models of olfactory perception.

  • Comparative genomics: Studying OR2F1 homologs across species to understand evolutionary conservation and divergence.

  • Single-cell transcriptomics: Characterizing OR2F1 expression patterns in olfactory sensory neurons.

  • In vivo imaging: Visualizing OR2F1-expressing neuron activation patterns in response to odorants.

  • Psychophysical correlations: Connecting OR2F1 activation patterns to human odor perception.

These interdisciplinary approaches acknowledge that understanding OR2F1 requires integration across multiple levels of biological organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.