Recombinant Human Olfactory receptor 2F2 (OR2F2)

Shipped with Ice Packs
In Stock

Description

Introduction to OR2F2

Recombinant Human Olfactory Receptor 2F2 (OR2F2) is a member of the G protein-coupled receptor (GPCR) superfamily, specifically classified within the olfactory receptor (OR) family. Its official nomenclature follows the standardized format for ORs: ORnXm, where n denotes the family (2), X the subfamily (F), and m the individual gene (2). Synonyms include Olfactory receptor 7-1 and OR7-6, reflecting historical naming conventions and cross-referencing in genomic databases .

Molecular Structure

OR2F2 is a seven-transmembrane domain protein, typical of class A GPCRs, with extracellular N-terminal and intracellular C-terminal regions. Key structural features include:

FeatureDescription
Transmembrane DomainsHydrophobic α-helices spanning the membrane, forming a ligand-binding pocket
Binding PocketComposed of residues in transmembrane domains (e.g., TM3, TM5, TM6)
Intracellular LoopsInteract with G proteins (e.g., Gαolf) to initiate signaling cascades

Mechanism of Action

OR2F2 detects volatile odorants via a combinatorial code, where multiple receptors contribute to odor perception. Binding triggers:

  1. G Protein Activation: Coupling to Gαolf or Gαs subunits.

  2. cAMP Signaling: Adenylate cyclase converts ATP to cAMP, opening cyclic nucleotide-gated ion channels.

  3. Depolarization: Influx of Na⁺/Ca²⁺ ions initiates action potentials in olfactory sensory neurons .

Genomic Organization

OR2F2 belongs to family 2 of the human OR gene family, which includes 12 subfamilies (A–L). Genomic features:

AspectDetail
Chromosomal LocusLikely clustered with related ORs (common in OR gene evolution)
Copy-Number VariationPotential CNVs may influence olfactory perception variability
Pseudogene StatusFunctional in humans (unlike many primate ORs)

Evolutionary Trends

The OR family in primates has undergone relaxed selective pressure, leading to:

  • Pseudogene accumulation: ~60% of human OR genes are nonfunctional.

  • Reduced functional diversity: Humans retain ~400 functional ORs vs. 1,000+ in mice .

Deorphanization Challenges

OR2F2 remains orphan, with no confirmed ligands identified to date. Key barriers include:

ChallengeImpact on OR2F2 Research
Limited Heterologous ExpressionPoor yield in HEK293 or Hana3A cells without chaperones (RTP1/2)
Assay BiasResponses vary by cell type (e.g., HEK vs. spermatozoa)
Low Ligand SpecificityBroad tuning of ORs complicates agonist identification

Comparative Insights from Related ORs

While OR2F2’s ligands are unknown, other ORs provide context:

OR SubtypeKnown LigandsBiological Role
OR2H1Methional (garlic-like odor)Sperm chemotaxis
OR10J1Dimetol (minty odor)Sperm motility
OR51E2β-Ionone (woody, floral)Olfactory epithelial signaling

Expression Systems

Recombinant OR2F2 is typically produced in mammalian cells (e.g., HEK293) with:

  • Chaperones: RTP1/2, REEP1, or olfactory-specific G proteins.

  • Tagging: N-terminal FLAG or His tags for purification .

Applications in Research

ApplicationUtility
Ligand ScreeningHigh-throughput assays for odorant discovery
Structural StudiesCryo-EM or X-ray crystallography (limited by OR2F2’s flexibility)
Olfactory ModelingPredicting odorant perception patterns

Key Challenges

  1. Low Functional Expression: Requires optimized systems (e.g., insect cells).

  2. Ligand Promiscuity: Overlapping agonist profiles hinder specificity.

  3. Ethical Concerns: Potential misuse in synthetic biology for odor manipulation.

Future Research Priorities

  1. OR2F2 Deorphanization: Targeted screening of sulfur-containing compounds (e.g., thiols).

  2. Structural Elucidation: Homology modeling using OR51E2 (first human OR structure solved) .

  3. Population Studies: Assess CNV impacts on OR2F2 expression and olfactory phenotypes .

Table 2: OR2F2-Related Resources

ResourceDescription
M2OR DatabaseCurates OR-molecule interactions (no OR2F2 entries as of 2023)
LSBio CatalogProvides recombinant OR2F2 for research (product ID: G190619)
GeneBioSystemsAnalogous recombinant ORs (e.g., OR2V2)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR2F2; Olfactory receptor 2F2; Olfactory receptor 7-1; OR7-1; Olfactory receptor OR7-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR2F2
Target Protein Sequence
MEIDNQTWVREFILLGLSSDWCTQISLFSLFLVTYLMTVLGNCLIVLLIRLDSRLHTPMY FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY DRHVAVSDRLRYSAIMHGGLCARLAITSWVSGSINSLVQTAITFQLPMCTNKFIDHISCE LLAVVRLACVDTSSNEAAIMVSSIVLLMTPFCLVLLSYIRIISTILKIQSREGRKKAFHT CASHLTVVALCYGTTIFTYIQPHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGA WHKLLEKFSGLTSKLGT
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8247

KEGG: hsa:135948

STRING: 9606.ENSP00000386222

UniGene: Hs.553596

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of OR2F2?

OR2F2, like other olfactory receptors, belongs to the G-protein coupled receptor (GPCR) superfamily. It features the canonical seven transmembrane domain (7TM) structure characteristic of GPCRs, with three intracellular loops (ICLs) and three extracellular loops (ECLs) . The protein contains binding pockets that determine ligand specificity, similar to what has been observed in other olfactory receptors like OR51E2. Understanding this structural classification is essential for predicting potential binding sites and designing experiments to investigate ligand interactions .

How do expression patterns of OR2F2 differ from other olfactory receptors?

While specific OR2F2 expression patterns must be experimentally determined, olfactory receptors generally show varied expression profiles. Unlike receptors such as OR51E2, which is expressed both in olfactory neurons and non-olfactory organs like the prostate , the expression pattern of OR2F2 requires targeted investigation. Researchers should employ RT-PCR, immunohistochemistry, and in situ hybridization to map tissue-specific expression. This mapping is crucial for understanding the receptor's potential physiological roles beyond olfaction and identifying suitable model systems for heterologous expression .

What methodologies are recommended for initial characterization of OR2F2 binding properties?

For initial characterization, researchers should consider a multi-faceted approach including:

  • Computational prediction of binding pocket characteristics using homology modeling based on related receptors like OR51E2

  • Heterologous expression systems optimized for GPCRs, particularly those successful with other olfactory receptors

  • Functional assays measuring calcium influx or cAMP production following receptor activation

  • Binding assays with progressive series of potential ligands to determine specificity

These methods help establish baseline binding properties while accounting for the typically enclosed binding pocket structure observed in other olfactory receptors . Comparing predicted binding pocket volume (similar to the 31 ų observed in OR51E2) can provide initial insights into potential ligand size constraints .

How should factorial experiments be designed to test multiple variables affecting OR2F2 binding efficiency?

When designing factorial experiments to investigate OR2F2 binding, researchers should implement a systematic approach considering:

  • Key factors including pH, temperature, ligand concentration, and membrane composition

  • At minimum, a 2×2×2 factorial design to investigate three key factors at two levels each

  • Randomization of experimental runs to reduce potential bias in results

  • Analysis methods including ANOVA or regression analysis to identify both main effects and interactions

The factorial approach is particularly valuable for OR2F2 research as it can reveal unexpected interactions between factors that might be missed in one-factor-at-a-time experimentation . For example, membrane composition and temperature might interact to significantly affect receptor stability and binding properties, similar to the interactions observed in bearing performance in Box's research .

What structural analysis techniques are most effective for determining OR2F2 binding pocket characteristics?

Given the challenges in structural determination of olfactory receptors, a combined approach is recommended:

  • Cryo-electron microscopy, which has successfully elucidated structures of related olfactory receptors

  • Molecular dynamics simulations to model ligand-receptor interactions and conformational changes

  • Integration with AlphaFold2 protein structure predictions to compensate for experimental limitations

  • Site-directed mutagenesis of predicted binding pocket residues to validate computational models

This integrated approach is necessary because traditional structural determination methods face challenges with olfactory receptors due to their typically low expression levels, the volatility of potential ligands, and inherent protein instability . The strategy mirrors successful approaches with OR51E2, where structural insights revealed a compact, enclosed binding pocket that determines ligand specificity .

How can molecular dynamics simulations be optimized for investigating OR2F2 activation mechanisms?

Molecular dynamics simulations for OR2F2 should be optimized through:

  • Implementation of appropriate force fields calibrated for membrane proteins

  • Extended simulation timeframes to capture complete activation dynamics

  • Focus on specific structural elements like ECL3, which has been shown to undergo significant conformational changes during olfactory receptor activation

  • Inclusion of the lipid bilayer environment to accurately model the native receptor context

These optimizations are critical since molecular dynamics simulation has proven "a potent and indispensable tool for delving into the intricate dynamics exhibited by biomolecules," especially for olfactory receptors where experimental structures may be limited . Simulations should particularly focus on potential conformational changes in the receptor's extracellular domains, as these have been implicated in activation mechanisms of related receptors .

What expression systems are most suitable for producing sufficient quantities of functional OR2F2 protein?

Based on challenges encountered with other olfactory receptors, researchers should consider:

Expression SystemAdvantagesLimitationsOptimization Strategies
HEK293 CellsMammalian processingModerate yieldN-terminal fusion tags; temperature reduction
Insect CellsHigher yield potentialDifferent glycosylationBaculovirus expression optimization
Cell-Free SystemsRapid productionMay lack proper foldingAddition of nanodiscs or lipid environments
Specialized E. coli StrainsCost-effectiveInclusion body formationFusion with solubility enhancers; low temperature

The optimal strategy draws from successful approaches with OR51E2, where researchers selected systems based on the receptor's expression in non-olfactory tissues, suggesting better stability in heterologous environments . Consider that characteristics of the expression system may significantly impact receptor folding and functionality, potentially affecting binding studies.

What computational methods should be employed for predicting potential OR2F2 ligands?

A comprehensive computational approach should include:

  • Homology modeling based on known olfactory receptor structures, particularly OR51E2

  • Virtual screening of compound libraries against the predicted binding pocket

  • Molecular docking simulations to evaluate binding energies and conformations

  • Pharmacophore modeling based on identified ligands to refine prediction criteria

These methods should take into account the specific binding pocket characteristics observed in olfactory receptors, including both polar interactions (hydrogen and ionic bonds) and hydrophobic interactions . The binding pocket volume constraints (comparable to the 31 ų observed in OR51E2) should be carefully considered when predicting compatible ligands .

How should site-directed mutagenesis studies be designed to investigate the binding pocket of OR2F2?

Site-directed mutagenesis studies should follow a structured approach:

  • Initial target selection based on computational prediction of binding pocket residues

  • Prioritization of residues likely involved in polar interactions (hydrogen and ionic bonds)

  • Systematic mutation of hydrophobic residues that may define binding pocket volume

  • Creation of a mutation series that progressively alters binding pocket size, similar to the studies where phenylalanine and leucine mutations to alanine expanded the binding pocket of OR51E2

Each mutant should undergo functional characterization using standardized assays to determine how specific residue changes affect binding affinity and selectivity. This approach builds on insights from OR51E2 research, where mutations that enlarged the binding pocket facilitated activation by larger ligands, demonstrating that "the volume of the binding pocket plays a pivotal role in determining the receptor's selectivity for odorant molecules" .

How can researchers overcome stability issues when working with recombinant OR2F2?

Addressing stability challenges requires a multi-faceted approach:

  • Incorporation of stabilizing mutations identified through computational prediction

  • Utilization of nanodiscs or lipid cubic phase environments to mimic native membrane conditions

  • Addition of cholesterol or specific lipids known to enhance GPCR stability

  • Implementation of fusion partners that have demonstrated success with other olfactory receptors

These strategies address the "inherent instability of purified olfactory receptor proteins" that has been noted in research on related receptors . The approach should be tailored based on the specific experimental goals, with different stability requirements for binding studies versus structural determination methods.

What methods are most effective for resolving contradictory data in OR2F2 ligand identification studies?

When faced with contradictory results in ligand identification:

  • Implement cross-validation using multiple, orthogonal assay types (functional, binding, and structural)

  • Evaluate experimental conditions systematically through factorial design to identify variables affecting outcomes

  • Consider receptor polymorphisms or post-translational modifications that might explain divergent results

  • Authenticate ligand identity and purity through analytical chemistry techniques

This methodological approach recognizes that contradictions often arise from unrecognized variable interactions, which factorial experimental designs are specifically constructed to identify . The analysis should include careful examination of both main effects and interaction effects to understand complex patterns in the data.

How should researchers distinguish between direct and allosteric effects in OR2F2 activation studies?

Distinguishing direct binding from allosteric effects requires:

  • Binding studies with radiolabeled or fluorescently tagged ligands to identify direct interactions

  • Comparative analysis of dose-response curves with and without potential allosteric modulators

  • Mutational analysis targeting residues in different receptor domains to identify allosteric pathways

  • Time-resolved studies examining the sequence of conformational changes following ligand application

This approach recognizes the complex activation mechanisms observed in olfactory receptors, where ligand binding can trigger structural changes in specific domains like ECL3 that propagate to affect receptor activation . The investigation should consider both the specific binding pocket interactions and the subsequent conformational changes that lead to G-protein coupling.

How can integrative approaches enhance our understanding of OR2F2 function in different physiological contexts?

Advancing OR2F2 research requires integrative approaches combining:

  • Tissue-specific expression profiling to identify all physiological contexts where OR2F2 functions

  • Generation of knockout models to assess phenotypic consequences across multiple systems

  • Integration of structural studies with in vivo functional assessments

  • Comparative analysis with other olfactory receptors to identify conserved and unique features

This integrative strategy addresses the emerging understanding that olfactory receptors function beyond the olfactory system, as demonstrated by OR51E2's expression in non-olfactory organs . The approach facilitates a comprehensive understanding of OR2F2's biological significance across different physiological contexts.

What novel experimental paradigms might reveal unexpected roles of OR2F2 beyond olfaction?

To investigate potential non-canonical functions of OR2F2:

  • Screening for OR2F2 activation by endogenous metabolites and signaling molecules

  • Analysis of OR2F2 expression in response to inflammatory mediators or disease states

  • Examination of potential interactions with non-traditional downstream effectors beyond canonical G-protein pathways

  • Investigation of OR2F2 in developmental processes through temporal expression analysis

These approaches acknowledge that olfactory receptors may have evolved additional functions beyond odor detection, similar to how OR51E2 serves roles in multiple tissue types . The exploration should remain open to unexpected findings that could significantly expand our understanding of OR2F2's biological importance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.