Recombinant Human Olfactory receptor 2G3 (OR2G3)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Challenges

Producing recombinant OR2G3 faces hurdles common to olfactory receptors:

  • Low native expression: Olfactory receptors are notoriously difficult to express in heterologous systems due to poor solubility and trafficking .

  • Strategies for recombinant production:

    • Use of rhodopsin tags to enhance membrane localization .

    • Co-expression with chaperones like RTP1S to improve folding and surface expression .

    • AlphaFold2 predictions to model 3D structures and guide mutagenesis studies .

No published studies have yet reported successful recombinant expression or deorphanization (ligand identification) for OR2G3.

Functional Insights from Related Olfactory Receptors

While direct data on OR2G3 is scarce, mechanisms observed in structurally similar ORs provide clues:

ReceptorLigand SpecificityBinding Pocket FeaturesFunctional Role
OR51E2Short-chain fatty acids (e.g., propionate)Compact hydrophobic pocket (31 ų)Prostate cancer biomarker; regulates cell proliferation
OR2J3Helional, coumarinECL2/ECL3-mediated stabilizationApoptosis induction in lung cancer
OR2B6UndeterminedUndeterminedBiomarker in breast carcinoma
OR2G3UnknownPredicted similar to OR51E2Hypothesized roles in odor detection or ectopic signaling

Key inferred characteristics for OR2G3:

  • Likely detects small, volatile odorants based on binding pocket volume constraints .

  • May participate in non-olfactory processes, as seen with OR51E2 (prostate function) and OR2J3 (serotonin regulation) .

Diagnostic and Therapeutic Potential

  • Cancer biomarkers: ORs like OR51E2 and OR2B6 show tumor-specific expression ; OR2G3 could have similar utility if validated.

  • Drug targets: Structural modeling of OR2G3’s ligand-binding domain might enable synthetic ligand design .

Critical Unanswered Questions

  • Ligand specificity: No odorants or endogenous molecules are known to activate OR2G3.

  • Signal transduction: Unclear whether it couples to canonical Gα<sub>olf</sub> pathways or alternative effectors .

  • Ectopic expression: Tissue distribution beyond the olfactory epithelium remains unstudied.

Future Directions

  1. Cryo-EM studies to resolve OR2G3’s structure, building on success with OR51E2 .

  2. High-throughput screening using odorant libraries to identify activating ligands.

  3. Transcriptomic analyses to map OR2G3 expression in non-olfactory tissues, informed by findings in pancreatic and prostate cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
OR2G3; Olfactory receptor 2G3; Olfactory receptor OR1-33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2G3
Target Protein Sequence
MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMY FFLSNLSLLDICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMAL DRYIAVCKPLHYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICE VPALLKLACVDTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFST CSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEA LRKLLSGKL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15008

KEGG: hsa:81469

STRING: 9606.ENSP00000326301

UniGene: Hs.653227

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2G3 and what is its functional significance?

OR2G3 (Olfactory Receptor Family 2 Subfamily G Member 3) is a G protein-coupled receptor belonging to the large family of olfactory receptors. These receptors function within the olfactory system's combinatorial code where individual odorants can activate multiple receptors, and individual receptors can respond to several different molecules . OR2G3, like other olfactory receptors, is involved in the initial detection of odorant molecules that ultimately leads to odor perception.

The functional characterization of specific ORs like OR2G3 requires experimental verification through bioassays. Similar to other characterized ORs, OR2G3 likely contributes to the discriminatory capacity of the human olfactory system, enabling the differentiation of thousands of distinct odors despite having a relatively limited number of receptors . Understanding OR2G3's specific ligand profile helps elucidate its role within the broader olfactory detection network.

What experimental systems are commonly used to study OR2G3 expression and function?

Multiple experimental systems are employed to study olfactory receptors like OR2G3. The most common heterologous expression system is the Hana3A cell line, which expresses chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag to facilitate proper OR trafficking to the cell membrane . This system is particularly valuable for deorphanization studies that aim to identify specific ligands for ORs.

For studying OR expression at the protein level, immunocytochemical staining with antibodies specific to the receptor of interest is commonly employed. The specificity of these antibodies should be verified using recombinantly expressed rho-tagged ORs in appropriate cell lines before application to tissue samples . Additionally, techniques such as RNA-Seq can be used to characterize OR transcript expression in various tissues, providing complementary data to protein-level studies .

How are ligands for OR2G3 identified and validated?

Ligand identification for olfactory receptors follows a systematic approach involving:

  • Heterologous expression: OR2G3 is expressed in a cell system such as Hana3A cells that contains the necessary molecular machinery for OR function .

  • Screening with odorant mixtures: The transfected cells are exposed to various odorant mixtures, and receptor activation is measured using calcium imaging techniques .

  • Validation of specific agonists: Individual compounds that show activity in the initial screening are tested separately to confirm specific activation of the receptor .

  • Dose-response analysis: Once candidate ligands are identified, concentration-dependent responses are measured to determine parameters such as EC50 values .

  • Verification in native systems: For conclusive validation, the identified ligands should demonstrate activity in systems that naturally express the receptor .

The process requires careful experimental design with appropriate controls, including mock-transfected cells that should show no specific odorant-induced calcium signals for any tested compounds .

What technical challenges are associated with recombinant OR2G3 expression?

Recombinant expression of olfactory receptors, including OR2G3, presents several technical challenges:

  • Poor membrane trafficking: ORs often show poor trafficking to the plasma membrane in heterologous systems, necessitating co-expression with chaperone proteins like RTP1, RTP2, and REEP1 .

  • Protein misfolding: ORs are prone to misfolding when expressed recombinantly, which may require optimization of expression conditions, including temperature adjustments and specialized cell lines .

  • Functional verification: Confirming that the recombinantly expressed OR maintains its native functionality requires reliable assays that can detect receptor activation upon ligand binding .

  • Antibody specificity: Due to the high sequence similarity among OR family members, developing specific antibodies for OR2G3 requires rigorous validation to ensure they do not cross-react with other ORs .

  • Expression level variability: Expression levels can vary significantly between experiments, necessitating internal controls and normalization procedures for quantitative comparisons.

How does concentration dependence affect OR2G3 response profiles to odorants?

Olfactory perception is highly concentration-dependent, with changes in odorant concentration potentially leading to different perceptions of hedonicity or olfactory quality . At the molecular level, OR2G3, like other ORs, demonstrates concentration-dependent activation profiles that significantly influence cellular signaling.

When designing experiments to study OR2G3 concentration-response relationships, researchers should:

  • Test a wide range of concentrations (typically from nM to μM)

  • Include measurements of both screening concentration and EC50 values

  • Account for stereochemistry of test molecules, as certain ORs demonstrate different responses to enantiomers

  • Control for potential off-target effects at higher concentrations

The comprehensive understanding of concentration-dependence is essential for accurately mapping OR2G3's response profile and comparing results across different experimental conditions.

What are the methodological considerations for calcium imaging in OR2G3 activation studies?

Calcium imaging is a primary technique for studying OR activation, including OR2G3. The technique relies on detecting changes in intracellular calcium concentration upon receptor activation. Several methodological considerations are critical for obtaining reliable results:

  • Selection of calcium indicators: Appropriate fluorescent calcium indicators should be selected based on sensitivity requirements and cellular localization preferences.

  • Control for direct CatSper activation: Some odorants can directly activate calcium-permeable channels like CatSper without receptor involvement. Including inhibitors such as mibefradil can help distinguish between direct channel activation and OR-mediated responses .

  • Extracellular calcium dependence: Odorant-induced calcium signals strongly depend on extracellular calcium entry through calcium-permeable channels. Experiments should be designed to differentiate between calcium release from intracellular stores and calcium influx from the extracellular environment .

  • Signal pathway analysis: While some odorant-induced calcium responses are independent of adenylyl cyclase activation and second messengers (cAMP and cGMP), others may involve G protein-mediated signaling cascades. Multiple pathway inhibitors should be tested to elucidate the specific mechanism for OR2G3 .

  • Temporal resolution: High temporal resolution imaging is necessary to capture the rapid kinetics of calcium responses, which can occur within seconds of odorant application.

How can genomic and functional data be integrated to understand OR2G3's role in the olfactory code?

Integration of genomic and functional data provides a comprehensive understanding of OR2G3's role in olfactory perception. This multi-omics approach combines:

  • Genomic sequence analysis: Comparative sequence analysis of OR2G3 across individuals and species can identify conserved regions critical for function and polymorphisms that might influence ligand specificity.

  • Transcriptomic profiling: RNA-Seq analysis of olfactory tissues helps determine the expression levels of OR2G3 relative to other ORs and identify potential co-expression patterns that might indicate functional relationships .

  • Functional characterization: Deorphanization studies identifying specific ligands for OR2G3 provide crucial information about its molecular recognition spectrum .

  • Structure-activity relationship analysis: Examining the chemical properties of OR2G3 ligands can reveal structural features important for receptor binding and activation.

  • Database integration: Utilizing resources like the M2OR database (https://m2or.chemsensim.fr/) allows researchers to place OR2G3 data within the broader context of OR-molecule interactions .

To effectively integrate these data types, researchers should:

  • Employ standardized experimental protocols to ensure data comparability

  • Develop computational models that can predict OR responses based on molecular structure

  • Utilize database systems that capture relationships between experimental designs, chemical properties, and functional outcomes

  • Consider population-level genetic variation that might influence OR2G3 function

What experimental design principles are critical for reliable OR2G3 deorphanization studies?

Deorphanization studies aim to identify ligands for orphan receptors like OR2G3. The reliability of these studies depends on robust experimental design principles:

How should contradictory data in OR2G3 activation studies be analyzed and reconciled?

Contradictory data in OR2G3 activation studies is common due to variations in experimental systems and methodologies. A systematic approach to analyzing and reconciling such contradictions includes:

  • Methodological comparison: Carefully examine the experimental methods used in contradictory studies, focusing on:

    • Cell lines used for heterologous expression

    • Co-expressed accessory proteins

    • Assay types (e.g., luciferase assays, calcium imaging)

    • Odorant concentrations and purities

  • Statistical reassessment: Reanalyze the statistical approaches used in contradictory studies to ensure appropriate:

    • Handling of outliers

    • Threshold determination for positive responses

    • Multiple testing corrections

    • Power analysis to evaluate sample sizes

  • Cross-validation experiments: Design experiments specifically to address contradictions by:

    • Testing both methodologies in parallel

    • Standardizing key variables between methods

    • Including appropriate positive and negative controls

  • Meta-analysis approach: When multiple datasets exist, conduct a formal meta-analysis that:

    • Weights studies based on methodological rigor

    • Identifies patterns across studies despite individual variations

    • Quantifies the degree of heterogeneity between studies

  • Database integration: Utilize comprehensive databases like M2OR to place contradictory results in context with the broader literature on OR-odorant interactions .

The reconciliation process should acknowledge that apparent contradictions may reflect biological reality—the same receptor might indeed behave differently under varied experimental conditions due to factors like post-translational modifications, membrane composition, or interacting proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.