Recombinant Human Olfactory receptor 2L8 (OR2L8)

Shipped with Ice Packs
In Stock

Description

Biological Significance of Olfactory Receptors

Olfactory receptors (ORs) represent the frontline sensory proteins responsible for detecting odorant molecules present in our surrounding environment. These specialized proteins belong to class A G-protein-coupled receptors (GPCRs) and constitute the largest transmembrane protein family in the human genome . The remarkable diversity of this receptor family underlies the human ability to perceive and distinguish between countless different odors, making it fundamental to our sensory experience and environmental awareness. Functional studies have revealed considerable variation within the OR family, with some members demonstrating broad responsiveness to many odorants while others exhibit highly selective activation patterns, responding to only a limited number of structurally related odorant molecules . This functional heterogeneity enables the sophisticated olfactory discrimination capabilities observed in humans and other mammals.

Classification and Genomic Organization

Olfactory receptors are typically classified into two major phylogenetic groups: class I and class II receptors. The human genome contains approximately 1,500 olfactory receptor genes, though a significant proportion exists as pseudogenes with disrupted open reading frames . According to genomic analyses, class II olfactory receptors constitute the majority of functional human ORs, while class I receptors represent a smaller, more ancient subset . The genomic organization of olfactory receptor genes follows a characteristic pattern, with most genes containing a single coding exon, although research has revealed that at least two-thirds of olfactory receptors exhibit multiple transcriptional variants with alternative isoforms in both 5' and 3' untranslated regions . Some transcripts (approximately 5%) even utilize splice sites within the coding region, which is contrary to the stereotyped olfactory receptor gene structure typically described in the literature .

Protein Structure and Classification

Human Olfactory receptor 2L8 (OR2L8), identified by UniProt ID Q8NGY9, is a member of the extensive olfactory receptor family . Like other olfactory receptors, OR2L8 is a G-protein-coupled receptor characterized by seven transmembrane domains that span the cell membrane of olfactory sensory neurons. The receptor belongs to class II olfactory receptors, which constitute approximately 89% of intact olfactory receptors in the human genome . As a GPCR, the protein is designed to bind specific odorant molecules in its binding pocket formed by the transmembrane domains, triggering a cascade of intracellular signaling events that ultimately lead to the perception of specific odors.

Challenges in GPCR Expression

The recombinant expression of olfactory receptors, including OR2L8, presents significant technical challenges that have historically hindered structural and functional studies of these proteins. Like many GPCRs, olfactory receptors are characterized by hydrophobic transmembrane domains that make them difficult to express, purify, and maintain in their native conformation outside of the cell membrane environment. Additionally, these receptors often undergo post-translational modifications that are essential for their proper folding, trafficking, and function, further complicating recombinant production efforts. Despite these challenges, several expression systems have been developed and optimized for the production of recombinant olfactory receptors, enabling advances in structural and functional studies of these important sensory proteins.

Baculovirus Expression System

The baculovirus expression system has emerged as a preferred platform for the production of recombinant olfactory receptors, including OR2L8 . This eukaryotic expression system utilizes insect cells infected with recombinant baculoviruses carrying the gene of interest, providing several advantages for the expression of complex membrane proteins. Commercial preparations of recombinant human OR2L8 produced via baculovirus expression systems typically achieve purity levels exceeding 85%, as determined by SDS-PAGE analysis . This system enables the production of properly folded and functional olfactory receptors that retain their ligand-binding properties, making it valuable for both structural studies and functional assays.

Mammalian Cell Expression Systems

Alternative approaches for olfactory receptor expression include mammalian cell-based systems, particularly HEK293 cells. Research on other olfactory receptors has demonstrated successful expression in stable tetracycline-inducible HEK293S cell lines, where receptors can be engineered with epitope tags to facilitate purification and detection . For instance, studies with the human olfactory receptor hOR1A1 have utilized a dual-tagging strategy, incorporating C-terminal rho1D4 and N-terminal FLAG epitope tags . These expression systems enable not only the production of recombinant receptors but also functional analyses using real-time cAMP assays to assess receptor activity in response to potential ligands.

ELISA-Based Detection Systems

Enzyme-linked immunosorbent assay (ELISA) kits have been developed for the quantitative measurement of human OR2L8 in various biological samples . These commercially available kits enable in vitro detection of OR2L8 in tissue homogenates, cell lysates, and other biological fluids, with test ranges typically spanning from 0.156 ng/ml to 10 ng/ml . The development of such immunoassays represents an important advancement in olfactory receptor research, enabling quantitative analyses of receptor expression levels across different tissues and experimental conditions. This capability is particularly valuable for studies investigating the expression patterns of olfactory receptors in both olfactory and non-olfactory tissues, as well as potential changes in expression associated with various physiological or pathological states.

Antibody-Based Detection Methods

Antibodies specifically targeting OR2L8 provide another essential tool for olfactory receptor research . These antibodies enable the detection, localization, and quantification of OR2L8 in various experimental contexts, including immunohistochemistry, western blotting, and flow cytometry applications. Commercial antibodies against OR2L8 have been developed to facilitate such studies, allowing researchers to investigate the expression patterns and subcellular localization of this receptor in different cell types and tissues. These immunological reagents complement the ELISA-based detection systems, providing researchers with multiple approaches for studying OR2L8 expression and distribution.

Ligand Binding and Functional Studies

The identification of specific ligands for individual olfactory receptors represents a major challenge and opportunity in olfactory research. Studies on other olfactory receptors have utilized intrinsic tryptophan fluorescence assays to quantify ligand binding, revealing affinities in the micromolar range for cognate odorants . Similar approaches could be applied to investigate the ligand specificity and binding properties of OR2L8. The development of high-throughput functional assays, including cAMP-based reporter systems and calcium imaging techniques, offers powerful tools for screening potential OR2L8 ligands and characterizing the receptor's response properties. Such functional studies are essential for understanding the role of OR2L8 in olfactory coding and its potential contributions to specific odor perceptions.

Potential Applications in Biotechnology and Medicine

The biotechnological applications of recombinant olfactory receptors, including OR2L8, extend beyond basic research into potential diagnostic and therapeutic domains. Olfactory receptors have been considered as potential biosensors for environmental monitoring and food quality assessment, leveraging their exquisite sensitivity and selectivity for specific chemical compounds. Additionally, the expression of olfactory receptors in non-olfactory tissues suggests potential roles in physiological processes beyond olfaction, including sperm chemotaxis, muscle regeneration, and cancer progression. Investigation of OR2L8 expression and function in these contexts may reveal novel biomedical applications for this receptor or its ligands.

Quality Control and Validation

The quality of recombinant OR2L8 preparations is typically assessed using various analytical methods, including SDS-PAGE for purity determination . Commercial preparations generally achieve purity levels exceeding 85%, as determined by these methods . Additional quality control measures may include mass spectrometry analysis for identity confirmation, functional assays to verify ligand-binding activity, and stability tests to ensure product consistency. These quality control procedures are essential for ensuring the reliability and reproducibility of experimental results obtained using recombinant OR2L8.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
OR2L8; Olfactory receptor 2L8; Olfactory receptor OR1-46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2L8
Target Protein Sequence
MENYNQTSTDFILLGLFPPSRIDLFFFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF LLSQLSLIDLNYISTIVPKMASDFLHGNKSISFTGCGIQSFFFLALGGAEALLLASMAYD RYIAICFPLHYLIRMSKRVCVLMITGSWIIGSINACAHTVYVLHIPYCRSRAINHFFCDV PAMVTLACMDTWVYEGTVFLSATIFLVFPFIGISCSYGQVLFAVYHMKSAEGRKKAYLTC STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL TRVSQRICSVKM
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15014

KEGG: hsa:391190

STRING: 9606.ENSP00000349719

UniGene: Hs.690212

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of the OR2L8 receptor?

Olfactory receptor 2L8 (OR2L8) is a protein encoded by the OR2L8 gene in humans. It belongs to the G-protein-coupled receptor 1 family with the characteristic 7-transmembrane domain structure shared by many neurotransmitter and hormone receptors . Like other olfactory receptors, OR2L8 arises from a single coding-exon gene and functions in the recognition and transduction of odorant signals through G protein-mediated pathways . The receptor consists of 312 amino acids and maintains the conserved structural features that enable interaction with odorant molecules to initiate neuronal responses that ultimately trigger smell perception .

How does OR2L8 interact with other proteins in signaling pathways?

String-db interaction network analysis reveals that OR2L8 has predicted functional partnerships with other olfactory receptors, most notably OR2L5 (with an interaction score of 0.782) . Additionally, OR2L8 interacts with GNAL, which encodes guanine nucleotide-binding protein G subunit alpha, an important component of the olfactory signal transduction cascade . These interactions form part of the complex signaling network through which olfactory receptors convert chemical stimuli into neuronal signals. The signaling pathway typically involves activation of adenylyl cyclase, production of cAMP, opening of cyclic nucleotide-gated channels, and eventual depolarization of the olfactory sensory neuron membrane .

What are the optimal conditions for expressing recombinant OR2L8 in heterologous systems?

Expressing functional olfactory receptors in heterologous systems presents significant challenges due to their hydrophobic nature and tendency to be retained in the endoplasmic reticulum. For successful expression of recombinant OR2L8:

  • Expression system selection: HEK293 cells are commonly used for OR expression due to their high transfection efficiency and ability to perform post-translational modifications.

  • Vector optimization: Vectors containing the Rho-tag sequence at the N-terminus of OR2L8 can enhance surface expression by facilitating proper protein trafficking.

  • Co-expression facilitators: Co-transfection with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) significantly improves functional expression of OR2L8 .

  • Culture conditions: Maintaining cells at 32°C rather than 37°C after transfection can enhance receptor trafficking to the plasma membrane.

  • Expression verification: Confirmation through techniques such as immunocytochemistry, flow cytometry, or Western blotting using receptor-specific or epitope tag antibodies is essential for validating successful expression.

For functional studies, calcium imaging or cAMP assays can be employed to measure receptor activation in response to potential ligands, with optimization of transfection efficiency being critical for obtaining reliable results.

What experimental approaches are recommended for studying OR2L8 gene expression in human olfactory tissue?

Studying OR2L8 expression in human olfactory tissue requires specialized techniques due to the relatively low abundance of receptor transcripts and the complexity of the tissue. Based on established methodologies:

  • Tissue collection: Whole human olfactory mucosa (WHOM) samples should be carefully collected and immediately preserved to maintain RNA integrity .

  • RNA extraction and quality control: High-quality RNA isolation is critical, with RIN (RNA Integrity Number) values above 7 being preferable for reliable results .

  • Quantitative expression analysis: Real-time reverse transcription PCR (qRT-PCR) using TaqMan Low Density Array (TLDA) technology has proven effective for investigating OR gene expression profiles . This approach offers superior sensitivity and reproducibility compared to other methods.

  • Normalization strategy: Two-tier normalization is recommended:

    • Technical normalization using endogenous control genes with minimal differential expression across tissues (MRPL19, CASC3, POLR2A, CDKN1B, TBP, RPL30, PSMC4, YWHAZ, UBC, PPIA)

    • Biological normalization using tissue-specific olfactory epithelium reference genes (CNGA2, GNAL, ADCY3, RIC8B, RTP1, OBP2A&2B)

  • Validation: Confirmation of expression patterns through orthogonal methods such as in situ hybridization or immunohistochemistry provides added confidence in the results.

This comprehensive approach enables reliable quantification of OR2L8 expression in human olfactory tissue and facilitates comparison across different samples and experimental conditions.

How can researchers effectively detect and characterize OR2L8 genetic variants?

For comprehensive detection and characterization of OR2L8 genetic variants:

  • Sample collection: Obtain genomic DNA from peripheral blood leukocytes using standard DNA extraction kits for high-quality template preparation .

  • Genotyping approach: The MassArray system has been successfully employed for OR2L8 variant detection, offering high-throughput screening capabilities . Alternatively, next-generation sequencing approaches provide comprehensive coverage.

  • Variant annotation: Use standard bioinformatics pipelines to annotate identified variants according to established nomenclature guidelines and predict functional consequences.

  • Genetic score calculation: For population studies, weighted genetic scores can be calculated to analyze the effect of the whole gene rather than individual SNPs . This approach provides greater statistical power for detecting associations with phenotypic traits.

  • Validation: Confirm novel variants through Sanger sequencing to eliminate false positives.

When studying OR2L8 variants in relation to phenotypic traits, consider potential gene-environment interactions, as these may significantly modify the effect of genetic variations on the phenotype of interest .

What is the association between OR2L8 genetic variants and metabolic phenotypes?

Research has established significant associations between OR2L8 genetic variants and obesity in Northern Han Chinese adults. In a comprehensive case-control study involving 301 obesity cases and 307 controls:

GeneOdds Ratio95% CIP-valueAssociation Direction
OR2L80.7080.504-0.9950.046Negative
OR4D11.5311.083-2.1640.016Positive
OR52K11.4371.055-1.9570.022Positive
CALML30.6010.410-0.8810.009Negative

The negative association between OR2L8 gene scores and obesity (OR = 0.708, 95% CI = 0.504-0.995, P = 0.046) suggests that certain OR2L8 variants may have protective effects against obesity development . This association remained significant after adjusting for potential confounding factors including age, sex, smoking, alcohol drinking, and physical activity .

These findings align with emerging evidence that olfactory receptors play important roles in metabolic regulation beyond their canonical functions in smell perception. The underlying mechanisms may involve:

  • Modulation of food preference and intake through altered olfactory perception

  • Direct effects on metabolic tissues where OR2L8 might be expressed

  • Interactions with other signaling pathways involved in energy homeostasis

Further research using animal models and functional studies are needed to elucidate the precise mechanisms through which OR2L8 variants influence obesity risk.

How does OR2L8 expression compare between normal and pathological tissue states?

While OR2L8 has not been specifically identified among the significantly upregulated olfactory receptors in breast cancer, comprehensive studies of OR gene expression in cancerous tissues provide important methodological frameworks for investigating OR2L8 in pathological conditions .

When studying OR2L8 expression in disease states:

  • Data sources: Utilize comprehensive genomic databases such as The Cancer Genome Atlas (TCGA) to analyze transcript abundance and DNA amplification patterns .

  • Analytical approach: Apply rigorous statistical methods to identify significant upregulation through:

    • Sum OR upregulation calculation

    • Weighted OR upregulation analysis

    • Determination of statistical significance thresholds

  • Integrative analysis: Correlate OR2L8 expression with:

    • Clinical parameters

    • Molecular subtypes of the disease

    • Survival outcomes

    • Other relevant biomarkers

  • Validation: Confirm computational findings through experimental approaches in cell lines and patient samples using qRT-PCR, immunohistochemistry, or other appropriate methods .

What are the challenges and solutions in developing functional assays for OR2L8 ligand discovery?

Developing robust functional assays for OR2L8 ligand discovery presents several challenges:

  • Receptor expression: Poor trafficking to the plasma membrane in heterologous systems often results in low surface expression.

    • Solution: Co-expression with accessory proteins such as RTP1, RTP2, REEP1, and Ric8b significantly enhances functional expression .

  • Assay sensitivity: Detecting the typically small responses of olfactory receptors to ligands.

    • Solution: Employ highly sensitive readout systems such as:

      • Modified G-protein coupling (Gα15/16) to route signaling to calcium mobilization

      • GPCR-activation-based sensor systems (e.g., GloSensor cAMP assay)

      • Luciferase reporter assays with high signal-to-noise ratios

  • Ligand diversity: The chemical space of potential odorants is vast and difficult to sample comprehensively.

    • Solution: Implement computational approaches for in silico screening to prioritize candidate ligands based on structural features and binding predictions.

  • Validation challenges: Confirming that observed responses are specific to OR2L8 activation.

    • Solution: Include multiple controls including:

      • Mock-transfected cells

      • Cells expressing other ORs

      • Dose-response analyses to establish potency and efficacy profiles

  • Physiological relevance: Translating in vitro findings to in vivo function.

    • Solution: Develop organotypic culture systems that better recapitulate the native environment of olfactory sensory neurons.

For the most robust results, a combination of heterologous expression systems, advanced biosensor technologies, and careful experimental design with appropriate controls is recommended.

What are the prospects for targeting OR2L8 in metabolic disease therapeutics?

The negative association between OR2L8 gene scores and obesity suggests potential for targeting this receptor in metabolic disease therapies . Key research avenues include:

  • Mechanism elucidation: Determining the precise molecular pathways through which OR2L8 influences metabolic parameters is essential for therapeutic development. This requires:

    • Tissue-specific knockout models

    • Cell-based signaling studies

    • Metabolomic profiling

  • Ligand identification: Discovery of endogenous and synthetic ligands that modulate OR2L8 activity could provide leads for therapeutic development. Both agonists and antagonists may have value depending on the desired metabolic effect.

  • Gene-environment interactions: Further investigation of how OR2L8 variants interact with environmental factors like smoking is crucial, as significant interactions have been observed with other olfactory receptors . This approach may lead to personalized interventions based on genotype.

  • Drug delivery challenges: Development of delivery systems that can effectively target OR2L8 in relevant tissues while minimizing off-target effects represents a significant technical challenge.

  • Combination approaches: Exploring how OR2L8 modulation might complement existing metabolic disease therapies could provide more effective treatment strategies.

Translational research bridging the gap between genetic association findings and practical therapeutic applications will be essential for realizing the potential of OR2L8 as a therapeutic target in metabolic disorders.

How might single-cell transcriptomics advance our understanding of OR2L8 biology?

Single-cell transcriptomics offers transformative potential for understanding OR2L8 biology by revealing:

  • Cell-type specific expression patterns: Determining exactly which cell types express OR2L8 in both olfactory and non-olfactory tissues at unprecedented resolution.

  • Developmental trajectories: Tracking OR2L8 expression during cellular differentiation and development to understand when and how expression is regulated.

  • Co-expression networks: Identifying genes consistently co-expressed with OR2L8 in specific cell types, providing insights into functional relationships and signaling pathways.

  • Response to stimuli: Characterizing transcriptional changes in OR2L8-expressing cells following exposure to potential ligands or physiological challenges.

  • Disease-associated alterations: Detecting subtle changes in OR2L8 expression or in OR2L8-expressing cell populations that may occur in disease states.

Technical approaches should include:

  • Single-cell RNA sequencing of olfactory epithelium

  • Spatial transcriptomics to preserve tissue architecture information

  • Integrated analysis with epigenomic and proteomic data

  • Computational trajectory inference to map developmental and differentiation pathways

This multi-dimensional characterization would significantly advance our understanding of OR2L8's physiological roles and potential involvement in disease processes.

What control mechanisms should be implemented when studying OR2L8 function in vitro?

Robust experimental design for studying OR2L8 function requires comprehensive control mechanisms:

  • Expression controls:

    • Empty vector transfections to control for transfection effects

    • Expression of a non-functional OR2L8 mutant (e.g., with mutations in key signaling residues)

    • Quantification of receptor expression levels through qPCR, Western blotting, or flow cytometry

  • Functional assay controls:

    • Positive control receptor with known ligand response

    • Multiple negative control compounds structurally distinct from test ligands

    • Dose-response curves to establish specificity and potency

    • Testing in multiple cell lines to control for cell type-specific effects

  • Signaling pathway validation:

    • Pharmacological inhibitors of known downstream signaling components

    • siRNA knockdown of key signaling molecules

    • Measurement of multiple readouts (e.g., cAMP, calcium, ERK phosphorylation)

  • Genetic controls:

    • CRISPR-Cas9 engineered OR2L8 knockout cells as negative controls

    • Rescue experiments with wild-type OR2L8 in knockout backgrounds

    • Testing of OR2L8 variants to establish structure-function relationships

  • Reproducibility measures:

    • Biological replicates from independent transfections

    • Technical replicates within each experiment

    • Repetition across different experimental batches

Implementation of these control mechanisms ensures that observed effects can be confidently attributed to OR2L8 function rather than experimental artifacts or non-specific effects.

What considerations are important when designing studies to examine OR2L8 genetic associations?

When designing studies to investigate OR2L8 genetic associations with phenotypic traits:

  • Study population selection:

    • Define clear inclusion/exclusion criteria

    • Consider ethnic background due to population-specific genetic architecture

    • Account for potential confounders like age, sex, and environmental exposures

  • Sample size determination:

    • Conduct power calculations based on expected effect sizes

    • Consider the number of variants being tested to account for multiple testing

    • Plan for adequate representation of different genotypes

  • Genotyping strategy:

    • Select appropriate technology based on study objectives (targeted genotyping vs. sequencing)

    • Include tag SNPs that capture linkage disequilibrium blocks

    • Consider both common and rare variants

  • Statistical approach:

    • Utilize weighted genetic scores to capture cumulative effects across the gene

    • Test for gene-environment interactions, particularly with factors like smoking

    • Apply appropriate multiple testing correction

  • Validation planning:

    • Design replication cohorts with similar characteristics

    • Consider functional validation of significant associations

    • Plan meta-analyses when multiple smaller studies are available

The case-control study examining OR2L8 associations with obesity effectively implemented many of these considerations, including adjustment for potential confounders and analysis of gene-environment interactions, resulting in the identification of significant associations despite moderate sample size .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.