Recombinant Human Olfactory receptor 2M4 (OR2M4)

Shipped with Ice Packs
In Stock

Description

Protein Overview

OR2M4 (UniProt ID: Q96R27) is a 311-amino-acid protein encoded by the OR2M4 gene located on human chromosome 1q44 . Recombinant versions are produced in heterologous systems like E. coli or wheat germ, often fused with affinity tags (e.g., His or GST) for purification and detection .

Functional Insights

  • Role in Olfaction: Binds odorant molecules, activating G-protein-mediated signaling in nasal neurons .

  • Genetic Variability: Copy-number variations (CNVs) in the OR2M4 locus may influence olfactory receptor diversity .

  • Interactions: Direct protein-protein interactions detected via yeast two-hybrid and pull-down assays, though specific partners remain uncharacterized .

Research Applications

Recombinant OR2M4 is utilized in:

  1. Antibody Validation: Used as a positive control in Western blot (WB) and ELISA to test anti-OR2M4 antibodies .

  2. Ligand Screening: Facilitates high-throughput assays to identify odorant ligands .

  3. Structural Studies: Provides material for crystallography or NMR to resolve GPCR signaling mechanisms .

Challenges and Limitations

  • Low Natural Abundance: Native OR2M4 is scarce in tissues, necessitating recombinant production .

  • Undefined Ligands: The specific odorants activating OR2M4 remain unidentified .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2M4; Olfactory receptor 2M4; HTPCRX18; OST710; Olfactory receptor OR1-55; Olfactory receptor TPCR100
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2M4
Target Protein Sequence
MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMY FLLSQLSLMDLMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAY DRYVAICHPLQYTILMNPKLCVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCD VAALLPLSCTETSAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTT CSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTILTPMLNPLIYSLRNKEVFRA LQKVLKKRKLI
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8270

KEGG: hsa:26245

STRING: 9606.ENSP00000306688

UniGene: Hs.381309

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2M4 and what is its genomic location?

OR2M4 (olfactory receptor family 2 subfamily M member 4) belongs to the largest multigene family of G protein-coupled receptors (GPCRs) involved in odorant detection. OR2M4 is mapped to chromosome 1q44 in humans . As a member of the class A rhodopsin-like family of GPCRs, it contains the characteristic seven-transmembrane domain structure common to olfactory receptors . OR2M4 functions primarily in the detection of specific odorant molecules as part of the combinatorial code that enables odor discrimination.

What is the mechanism of action for olfactory receptors like OR2M4?

Olfactory receptors operate through a sophisticated signal transduction cascade:

  • The OR binds odorant molecules with varying affinities based on the physio-chemical properties of the molecules

  • Upon binding, the receptor undergoes conformational changes

  • This activates olfactory-type G proteins (Golf and/or Gs) on the intracellular side

  • The G protein then activates adenylate cyclase

  • Adenylate cyclase converts ATP into cyclic AMP (cAMP)

  • cAMP opens cyclic nucleotide-gated ion channels

  • Ca²⁺ and Na⁺ ions enter the cell, depolarizing the neuron

  • This initiates an action potential that transmits the signal to the brain

This process follows a combinatorial coding principle: a single odorant can activate multiple receptors, and each receptor can respond to several different odorants .

What experimental tools are available for studying OR2M4?

Several research tools are available for OR2M4 investigation:

Research ToolDescriptionApplicationReference
Anti-OR2M4 AntibodyPolyclonal antibody reactive to human OR2M4ELISA, Western Blot
OR2M4 CRISPR/Cas9 KO PlasmidPool of 3 plasmids encoding Cas9 and target-specific gRNAGene knockout studies
Recombinant OR2M4 proteinFull-length protein expression systemsStructural/functional studiesSimilar to
OR2M4 expression vectorsPlasmids for heterologous expressionFunctional characterizationSimilar to

These tools enable multiple experimental approaches including protein localization, functional characterization, and gene knockout studies to elucidate the biological roles of OR2M4.

What are the challenges in recombinant expression of OR2M4?

Recombinant expression of olfactory receptors like OR2M4 presents several significant challenges:

  • Poor trafficking to plasma membrane: ORs frequently fail to reach the cell surface in heterologous expression systems

  • Protein misfolding: High rates of improper folding during biosynthesis

  • Low expression yields: Typically achieving only 10⁶ receptors per cell in optimized systems

  • Post-translational modifications: Requirements for specific glycosylation patterns

  • Cell toxicity: Overexpression can lead to cellular stress responses

To overcome these challenges, researchers employ several strategies:

  • Fusion with trafficking enhancement tags

  • Co-expression with chaperone proteins like RTP1, RTP2

  • Use of specialized cell lines (e.g., Hana3A) designed for OR expression

  • Addition of N-terminal modification tags to improve membrane trafficking

  • Optimizing codon usage for the expression system

How can researchers functionally characterize recombinant OR2M4?

Functional characterization of OR2M4 requires multiple complementary approaches:

A. Expression System Selection:

  • Mammalian cell lines (HEK293T, Hana3A) provide the most physiologically relevant environment

  • Cell-free systems can produce protein for structural studies but may not maintain native conformation

B. Response Measurement Methods:

  • Luciferase reporter assays: Measuring cAMP-dependent luciferase activity

  • Calcium imaging: Detecting Ca²⁺ influx using fluorescent indicators

  • SEAP (Secreted embryonic alkaline phosphatase) assays: For detecting downstream pathway activation

  • Electrophysiology: Measuring membrane conductance changes directly

C. Ligand Screening Approach:

  • Begin with broad odor panels screening at higher concentrations

  • Determine EC₅₀ values for active compounds

  • Consider stereochemistry effects - certain ORs show differential responses to enantiomers

  • Validate findings across multiple assay types to address assay-dependent bias

D. Data Analysis:

  • Compare responses to negative and positive controls

  • Normalize data to account for variability in expression levels

  • Generate dose-response curves to determine potency and efficacy parameters

What computational approaches can help predict OR2M4-ligand interactions?

Computational methods are increasingly important for "deorphanizing" olfactory receptors like OR2M4:

  • Homology modeling and molecular docking:

    • When sequence identity with template structures is sufficient (>30%)

    • Docking software can predict binding poses and affinity

    • Challenges include modeling conformational dynamics and solvation effects

  • Machine learning approaches:

    • Deep learning frameworks like ALBERT pre-trained models show promise

    • Can achieve ROC-AUC of 0.725 and PR-AUC of 0.589 for predicting protein-ligand interactions

    • Particularly valuable when proteins are dissimilar from those with known structures

  • Sequence-based methods:

    • DISAE (Distilled Sequence Alignment Encoder) can predict ligands even for orphan proteins

    • Utilizes transformer-based architectures that outperform traditional LSTM models

    • Particularly valuable for OR2M4 where crystal structures are unavailable

  • Database resources and data mining:

    • The M2OR database (https://m2or.chemsensim.fr/) contains 75,050 bioassay experiments for OR-molecule pairs

    • Includes crucial information on stereochemistry, concentration, and experimental conditions

    • Can be used to train predictive models and identify structural patterns in OR ligands

How can the M2OR database be utilized for OR2M4 research?

The M2OR database provides valuable resources for investigating OR2M4:

  • Comprehensive data collection:

    • Contains 51,395 unique receptor-molecule pairs from published literature

    • Includes both responsive (6%) and non-responsive (94%) pairs, which is essential for understanding binding specificity

    • Provides stereochemical information, which is critical as some ORs respond differently to enantiomers

  • Research applications:

    • Structure-activity relationship analysis: Identifying molecular features that correlate with OR2M4 activation

    • Training machine learning models: The assay metadata can be used to estimate response confidence levels

    • Bioassay design: Information on concentration ranges, cell lines, and assay types facilitates experimental planning

    • Cross-receptor comparison: Understanding OR2M4's place in the combinatorial olfactory code

  • Search functionality:

    • Molecules can be queried to find responsive ORs

    • ORs can be queried to find potential ligands

    • Advanced filtering based on experimental parameters

What is the significance of OR2M4 expression in non-olfactory tissues?

Recent research has revealed unexpected expression of olfactory receptors in non-olfactory tissues, including OR2M4:

  • Expression in the retina:

    • RNA-Sequencing analysis has detected expression of several ORs in human retina

    • ORs can be localized to specific retinal cell types, suggesting unique biological functions

    • Some ORs are found at the base of photoreceptor connecting cilia or nuclear envelopes

  • Research methodology for detecting non-olfactory expression:

    • Use RNA-Seq with FPKM cutoff values >0.3 to distinguish from background

    • Validate expression through RT-PCR with primers detecting fragments of the OR open reading frame

    • Confirm transcript structures using the Integrative Genomics Viewer (IGV)

    • Perform immunohistochemistry to determine precise cellular and subcellular localization

  • Functional implications:

    • May participate in cellular signaling pathways beyond odor detection

    • Could represent potential targets for therapeutic intervention

    • May explain unexpected effects of certain compounds in non-olfactory tissues

How can CRISPR/Cas9 technology be applied to study OR2M4 function?

CRISPR/Cas9 provides powerful approaches for investigating OR2M4 function:

  • Gene knockout strategies:

    • OR2M4 CRISPR/Cas9 KO Plasmid utilizes a pool of 3 plasmids encoding Cas9 and target-specific gRNAs

    • Designed to cause double-strand breaks in a 5' constitutive exon within the OR2M4 gene

    • Enables complete elimination of functional protein expression

  • Experimental workflow:

    • Transfect target cells with OR2M4 CRISPR/Cas9 KO Plasmid

    • Select successfully transfected cells using appropriate markers

    • Verify knockout through genomic sequencing, RT-PCR, and western blotting

    • Analyze phenotypic changes in comparison to wild-type cells

  • Applications:

    • Determine the physiological role of OR2M4 in both olfactory and non-olfactory tissues

    • Create knockout cell lines for background controls in functional assays

    • Study compensatory mechanisms when OR2M4 is absent from the receptor repertoire

What methodological approaches can validate OR2M4-ligand interactions?

Validating OR2M4-ligand interactions requires multiple confirmatory approaches:

  • In vitro functional assays:

    • Different assay types (luciferase, calcium imaging, cAMP measurement)

    • Testing at multiple concentrations to generate dose-response curves

    • Comparing results across different expression systems (Hana3A, HEK293, etc.)

  • Structural validation:

    • Mutagenesis studies to identify critical binding residues

    • Competition assays with known ligands

    • Photoaffinity labeling to directly identify binding sites

  • In vivo validation approaches:

    • Calcium imaging in native olfactory sensory neurons

    • Electrophysiological recordings from neurons expressing OR2M4

    • Behavioral studies in animal models with modified OR2M4 expression

  • Data reporting standards:

    • Include complete information on experimental conditions, concentrations tested

    • Report both positive and negative results to build comprehensive understanding

    • Document stereochemistry properties of test compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.