Recombinant Human Olfactory receptor 2S2 (OR2S2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

OR2S2 belongs to the G-protein-coupled receptor (GPCR) family and is encoded by the OR2S2 gene located on chromosome 9p13.3 . As an olfactory receptor, it mediates odor perception by interacting with odorant molecules in the nasal epithelium, initiating neuronal signaling . Recombinant OR2S2 is produced in heterologous systems (e.g., E. coli) for structural and functional studies .

Production Methods

Recombinant OR2S2 is synthesized using optimized protocols:

  • Expression System: E. coli (common) or HEK293 cells for post-translational modifications .

  • Purification: Affinity chromatography (anti-FLAG/His tags) followed by gel filtration .

  • Yield: ~1.6 mg (monomeric) and ~1.1 mg (dimeric) per 60 T175 flasks .

  • Purity: >90% confirmed via SDS-PAGE .

Ligand Specificity

  • OR2S2’s exact ligands remain under investigation, but olfactory receptors generally recognize structurally related odorants (e.g., aldehydes, ketones) .

  • Functional assays (calcium imaging, electrophysiology) in HEK293 or Xenopus oocytes confirm receptor activation via odorants like helional .

Mechanistic Studies

  • Signaling: Odorant binding triggers Gα<sub>olf</sub>-mediated cAMP signaling, activating ion channels .

  • Dimerization: Purified OR2S2 exists in monomeric and dimeric forms, suggesting potential cooperative binding .

Research Applications

ApplicationDetails
Olfactory MechanismDecoding odorant-receptor interactions and combinatorial coding .
Disease LinkageInvestigating roles in neuronitis and neurodegenerative disorders .
Drug DiscoveryScreening for modulators targeting OR-related pathways .

Challenges in Study

  • Low Functional Yield: Poor membrane localization in heterologous systems requires chaperones (e.g., RTP1/2) .

  • Ligand Identification: Only ~6% of OR-odorant pairs are characterized, necessitating high-throughput screens .

Future Directions

  • Deorphanization: Leveraging databases like M2OR to identify OR2S2 ligands .

  • Structural Biology: Cryo-EM studies to resolve ligand-binding domains .

  • Therapeutic Targeting: Exploring OR2S2’s role in non-olfactory tissues (e.g., prostate, neurons) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order remarks and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
OR2S2; Olfactory receptor 2S2; Olfactory receptor OR9-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2S2
Target Protein Sequence
MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR NKDVKAAVRRLLRPKGFTQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8276

KEGG: hsa:56656

STRING: 9606.ENSP00000344040

UniGene: Hs.553540

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 2S2 (OR2S2) and how is it classified?

Olfactory Receptor 2S2 (OR2S2) belongs to the large family of olfactory receptors expressed in the olfactory sensory neurons. It is part of the approximately 400 intact human odorant receptors that encode our sense of smell through a combinatorial activation pattern . OR2S2 is classified among the olfactory receptors that interact with odorous molecules to trigger the mammalian sense of smell. Based on structural and functional characteristics, olfactory receptors are generally divided into Class I receptors (sensitive to cheese or vinegar-like smells) and Class II receptors (more versatile, detecting a wider range of scents) . While the specific classification of OR2S2 is not explicitly stated in the search results, its genomic location and functional properties place it within this olfactory receptor framework.

What is the genomic location of OR2S2 and what significant variants are associated with it?

OR2S2 is located on chromosome 9, with the significant variant rs141809766 positioned at 9:35,937,931 . This variant has been identified as significantly associated with "Rapid3" (a measure of rapid kidney function decline) in genome-wide association studies. Specifically, the variant has a minor allele frequency of 0.02, with the G allele being the reference and A being the alternate allele. The association with Rapid3 showed an odds ratio of 1.222 (P=5.94×10^-9), indicating a strong statistical significance . Notably, the OR2S2 locus is considered novel for eGFRcrea (estimated glomerular filtration rate based on creatinine) traits, suggesting previously undiscovered connections between olfactory receptor genetics and kidney function.

What methodologies are most effective for expressing recombinant OR2S2 in heterologous systems?

Based on established protocols for olfactory receptor research, heterologous expression of recombinant OR2S2 is most effectively achieved using specialized cell lines such as Hana3A cells. These cells are engineered to express accessory proteins that enhance olfactory receptor trafficking and function . The optimal transfection protocol involves:

  • Co-transfection with RTP1S (5 ng/well), which functions as a chaperone protein to facilitate receptor trafficking to the cell membrane

  • Addition of pRL-SV40 (5 ng/well) as a transfection control

  • Inclusion of CRE-luciferase (10 ng/well) as a reporter element

  • Co-expression of M3 (2.5 ng/well), which enhances receptor coupling to signaling pathways

  • Transfection of the OR2S2 expression vector (5 ng/well)

This approach optimizes membrane localization of the recombinant receptor and enables functional coupling to cellular signaling pathways, which is critical for subsequent screening and characterization experiments.

How can the luciferase assay be optimized for OR2S2 functional screening?

The Dual-Glo Luciferase Assay System represents the gold standard for functional screening of olfactory receptors, including OR2S2. For optimal results with OR2S2, the protocol should be implemented as follows:

  • Prepare transfected Hana3A cells as described in question 2.1

  • Prepare odorant stocks at 1M concentration in DMSO for maximum solubility

  • After 24 hours post-transfection, replace the transfection media with appropriate concentrations of test odorants diluted in CD293 medium

  • Allow a 4-hour stimulation period for optimal receptor activation and signal accumulation

  • Measure luminescence using a plate reader (e.g., Polarstar Optima)

  • Normalize all luminescence values by dividing by the Renilla Luciferase activity to correct for transfection efficiency variations

To establish a comprehensive activation profile, construct dose-response curves using concentrations ranging from 10 nM to 10 mM of potential ligands. An odorant can be classified as an agonist if:

  • The 95% confidence intervals of the top and bottom parameters do not overlap

  • The standard deviation of the fitted log EC50 is less than 1 log unit

  • The extra sums-of-squares test confirms that the odorant activates the receptor significantly more than the empty vector control

What is the association between OR2S2 and kidney function, and how can this be further investigated?

Genome-wide association studies have identified a significant association between the OR2S2 locus variant rs141809766 and rapid decline of kidney function (Rapid3) . This association represents a novel finding linking olfactory receptor genetics to kidney disease progression. The specific variant shows:

Variant IDChromosome PositionAssociated TraitNearest GeneRef/Alt AllelesMAFEffect SizeP-value (Rapid3)P-value (CKDi25)Locus Rank
rs1418097669:35,937,931Rapid3OR2S2g/a0.021.2225.94×10^-90.2524

To further investigate this association, researchers should consider:

  • Functional expression studies of OR2S2 in kidney tissues to determine if the receptor is expressed and active in renal cells

  • In vitro models using kidney cell lines transfected with wild-type and variant OR2S2 to assess potential differences in cellular signaling

  • Cohort studies examining whether OR2S2 variants correlate with biomarkers of kidney function and disease progression

  • Mechanistic studies to elucidate the potential role of olfactory signaling pathways in kidney physiology

This research direction represents an unexplored area that could reveal novel insights into both olfactory receptor function in non-olfactory tissues and kidney disease mechanisms.

How can structural biology approaches be applied to characterize OR2S2-ligand interactions?

Advanced structural biology techniques similar to those used in recent olfactory receptor research can be applied to characterize OR2S2-ligand interactions:

  • Model Receptor Engineering: Since direct structural studies of native human ORs remain challenging ("impossible to make in a test tube") , researchers can design model receptors based on the structure of OR2S2, focusing on the binding pocket region.

  • Cryo-electron Microscopy (cryo-EM): This technique allows for capturing detailed 3D images of the receptor-ligand complex at atomic-level resolution. For OR2S2, cryo-EM could reveal the specific binding modes of different odorants and conformational changes upon ligand binding .

  • Computational Simulations: Molecular dynamics simulations can model the movements and conformational changes of OR2S2 when interacting with different odorants. These simulations provide insights into the dynamic nature of receptor activation that static structural methods cannot capture .

  • Structure-Function Analysis: By combining structural data with functional assays (such as the luciferase assay), researchers can correlate structural features with receptor activation patterns, helping to define the molecular determinants of OR2S2 ligand specificity.

These approaches would provide unprecedented insights into how OR2S2 recognizes and responds to specific odorants at the molecular level.

What databases and resources are available for investigating OR2S2-ligand interactions?

The Molecule to Olfactory Receptor (M2OR) database (https://m2or.chemsensim.fr/) represents the most comprehensive resource for studying olfactory receptor-odorant interactions, potentially including data on OR2S2 . This database offers:

  • A curated collection of 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs

  • Information about receptor responses to molecules and mixtures

  • Receptor sequences and detailed experimental conditions

  • Crucially, both responsive and non-responsive OR-molecule pairs

  • Stereochemistry properties and concentration data for tested molecules

The M2OR database includes advanced search functionality allowing researchers to:

  • Search for molecules that activate OR2S2

  • Compare OR2S2 with other receptors in terms of ligand specificity

  • Access raw experimental results or curated aggregations

  • Perform batch searches using standard molecule and receptor identifiers

This resource is particularly valuable since it incorporates concentration data and stereochemistry information, which are critical factors in OR activation patterns. The database also allows filtering based on experimental conditions, enabling researchers to account for assay-dependent biases when interpreting OR2S2 responses .

How should dose-response data for OR2S2 activation be analyzed and interpreted?

Proper analysis of OR2S2 dose-response data requires a rigorous statistical approach:

  • Curve Fitting: Dose-response data should be fit to a sigmoidal curve using nonlinear regression. This allows extraction of key parameters including:

    • EC50 (half-maximal effective concentration)

    • Hill coefficient (slope of the curve)

    • Maximum response (Emax)

    • Basal activity

  • Statistical Validation: For conclusive identification of OR2S2 agonists, the following criteria should be applied:

    • The 95% confidence intervals of the top and bottom parameters must not overlap

    • The standard deviation of the fitted log EC50 should be less than 1 log unit

    • An extra sums-of-squares test should confirm that the odorant activates OR2S2 significantly more than control (empty vector)

  • Concentration Considerations: Since olfactory perception is highly concentration-dependent, analysis must account for how concentration affects OR2S2 activation patterns:

    • Low concentrations may yield no response

    • Increasing concentrations may activate OR2S2 and eventually recruit additional receptors

    • EC50 values should be compared across multiple experiments for consistency

  • Assay-Dependent Bias: The analysis should consider potential bias introduced by different experimental systems. For example, OR responses can differ significantly between different cell lines (e.g., LNCaP vs. HEK293), necessitating careful interpretation of results from different experimental platforms .

By following these analytical principles, researchers can generate reliable and reproducible data on OR2S2 activation patterns and ligand specificity.

How might OR2S2 function in non-olfactory tissues relate to disease mechanisms?

The unexpected association between OR2S2 variants and kidney function decline opens up several intriguing research questions:

  • Tissue-Specific Expression: While olfactory receptors are primarily expressed in olfactory sensory neurons, growing evidence suggests expression in other tissues. Investigating OR2S2 expression patterns in kidney tissue through immunohistochemistry, RT-PCR, and single-cell RNA sequencing could reveal cell-specific localization.

  • Signaling Pathways: OR2S2 likely couples to G-proteins in non-olfactory tissues, potentially activating different downstream pathways than in olfactory neurons. Characterizing these signaling cascades in kidney cells might elucidate mechanisms underlying the genetic association with eGFR decline.

  • Endogenous Ligands: While OR2S2 evolved to detect external odorants, in non-olfactory tissues it may respond to endogenous metabolites or signaling molecules. Metabolomic approaches coupled with receptor activation assays could identify kidney-specific ligands.

  • Genetic Models: Development of OR2S2 knockout or variant knock-in models would allow for direct assessment of its role in kidney function and disease progression. Both cell-based and animal models would provide complementary insights.

The exploration of OR2S2 function in non-olfactory tissues represents an emerging frontier that could establish new paradigms linking sensory receptor biology to internal physiology and disease mechanisms.

What technological advances might overcome current limitations in OR2S2 research?

Several emerging technologies hold promise for advancing OR2S2 research:

  • Single-Cell Analysis: Single-cell RNA sequencing and proteomics can reveal the heterogeneity of OR2S2 expression in both olfactory and non-olfactory tissues, providing context for understanding its diverse functions.

  • Advanced Structural Methods: While current structural biology approaches rely on engineered model receptors, advances in protein expression and stabilization techniques may eventually enable direct structural studies of native OR2S2.

  • Organoid Models: Olfactory and kidney organoids could provide more physiologically relevant systems for studying OR2S2 function compared to traditional heterologous expression systems.

  • AI-Assisted Ligand Discovery: Machine learning approaches trained on existing OR-ligand interaction databases could predict potential ligands for OR2S2, accelerating deorphanization efforts and providing insights into its activation patterns.

  • CRISPR-Based Functional Genomics: High-throughput CRISPR screening approaches could identify genes that modulate OR2S2 function, revealing new components of its signaling networks in different cellular contexts.

These technological advances will likely overcome current limitations in OR2S2 research, enabling more comprehensive characterization of this receptor's structure, function, and physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.