Recombinant Human Olfactory receptor 2T10 (OR2T10)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of OR2T10

Olfactory receptor 2T10 (OR2T10) is a protein encoded by the OR2T10 gene in humans. Also known as OR1-64, this receptor belongs to the largest gene family in the human genome – the olfactory receptor family . OR2T10 is classified as a G-protein-coupled receptor (GPCR) that arises from single coding-exon genes . The gene is located on chromosome 1 at position 1q44 (NC_000001.11, coordinates 248590487-248597700, complement strand) and contains two exons in total .

The primary function of OR2T10, like other olfactory receptors, is to interact with odorant molecules in the nasal cavity, initiating neuronal responses that ultimately trigger smell perception . These receptors exhibit a distinctive 7-transmembrane domain structure that is shared with many neurotransmitter and hormone receptors, facilitating the recognition and G protein-mediated transduction of odorant signals .

Production of Recombinant OR2T10

Recombinant OR2T10 protein is typically produced through expression in heterologous systems, primarily using Escherichia coli as the host organism . The full-length human OR2T10 protein can be produced with various fusion tags to facilitate purification and detection, with N-terminal His-tagging being a common approach . The recombinant protein spans the complete sequence (amino acids 1-312) of the native human protein .

Expression Systems and Purification

Multiple expression systems have been utilized for the production of recombinant OR2T10, including:

  1. Cell-free expression systems

  2. E. coli-based expression

  3. Yeast expression systems

  4. Baculovirus-infected insect cells

  5. Mammalian cell expression systems

Each system offers distinct advantages depending on the intended application. E. coli expression systems are frequently utilized due to their cost-effectiveness and high yield, though they may present challenges in producing properly folded membrane proteins .

The purification process typically involves affinity chromatography utilizing the His-tag, followed by additional purification steps to achieve high purity. The final product generally exhibits purity levels of 85-90% or greater as determined by SDS-PAGE analysis .

Basic Research in Olfactory Science

Recombinant OR2T10 serves as a valuable tool for investigating fundamental aspects of olfaction. Researchers utilize the purified protein to study:

  1. Ligand binding properties and specificity

  2. Structure-function relationships in olfactory receptors

  3. Signal transduction mechanisms

  4. Receptor-G protein interactions

These studies contribute to our understanding of how the human olfactory system recognizes and discriminates between thousands of different odorants.

OR2T10 in Cancer Research

Recent evidence suggests potential roles for olfactory receptors, including OR2T10, in various types of cancer . The Colorectal Cancer Atlas includes OR2T10 in its database, indicating potential relevance to colorectal cancer biology . Additionally, a 2025 study investigated olfactory receptor expression profiles in clear cell renal cell carcinoma (KIRC), though specific findings regarding OR2T10 were not detailed in the provided excerpts .

While OR2T10 was not among the 11 olfactory receptor genes with significant expression changes identified in the KIRC study, the broader investigation of olfactory receptors in cancer contexts suggests potential diagnostic or prognostic applications . Several olfactory receptors have demonstrated high diagnostic performance in distinguishing between normal and tumor tissues, with some showing associations with patient prognosis and exhibiting sex-based differences in expression .

Brain Expression Studies

The Human Protein Atlas has documented OR2T10 expression in brain tissue, suggesting potential functions beyond the traditional olfactory role . While olfactory receptors are primarily associated with olfactory sensory neurons in the nasal epithelium, their expression in other tissues, including brain regions, indicates possible non-olfactory functions that remain to be fully elucidated .

Challenges in Membrane Protein Research

As a membrane protein with seven transmembrane domains, OR2T10 presents specific challenges for structural and functional studies . These challenges include:

  1. Difficulties in obtaining sufficient quantities of properly folded protein

  2. Maintaining stability and functionality during purification

  3. Reconstituting the protein in appropriate membrane-mimetic environments

  4. Developing suitable assays for functional characterization

Researchers have employed various strategies to address these challenges, including the use of fusion partners, detergent screening, and lipid nanodisc technologies .

Validation and Quality Control

Quality control measures for recombinant OR2T10 typically include:

  1. SDS-PAGE analysis to confirm purity (≥85-90%)

  2. Western blotting for identity confirmation

  3. Functional assays to verify ligand binding capacity

  4. Mass spectrometry for accurate molecular weight determination

These validation steps are essential for ensuring that the recombinant protein accurately represents the native OR2T10 and is suitable for downstream applications.

Future Research Directions

Future investigations of OR2T10 may focus on several promising areas:

  1. Comprehensive ligand profiling to identify specific odorants recognized by OR2T10

  2. Structural studies using advanced techniques such as cryo-electron microscopy

  3. Further exploration of potential non-olfactory functions in diverse tissues

  4. Investigation of possible roles in pathological conditions, including cancer

  5. Development of OR2T10-targeted therapeutics or diagnostic tools

The continued refinement of recombinant protein production techniques will likely facilitate these research directions, enabling more detailed characterization of OR2T10's structure and function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. To ensure your specified tag type, please inform us, and we will prioritize its development.
Synonyms
OR2T10; Olfactory receptor 2T10; Olfactory receptor OR1-64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2T10
Target Protein Sequence
MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMY FFINQLSLIDLTYISVTVPKMLVNQLAKDKTISVLGCGTQMYFYLQLGGAECCLLAAMAY DRYVAICHPLRYSVLMSHRVCLLLASGCWFVGSVDGFMLTPIAMSFPFCRSHEIQHFFCE VPAVLKLSCSDTSLYKIFMYLCCVIMLLIPVTVISVSYYYIILTIHKMNSVEGRKKAFTT CSSHITVVSLFYGAAIYNYMLPSSYQTPEKDMMSSFFYTILTPVLNPIIYSFRNKDVTRA LKKMLSVQKPPY
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19573

KEGG: hsa:127069

STRING: 9606.ENSP00000329210

UniGene: Hs.553585

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.