Recombinant Human Olfactory receptor 2T12 (OR2T12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Please note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
OR2T12; Olfactory receptor 2T12; Olfactory receptor OR1-57
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2T12
Target Protein Sequence
MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFL LSQLSLMDMMLVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLLMRSTEARKKAFATCS SHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALK RWLGTCVNLKHQQNEAHRSR
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19592

KEGG: hsa:127064

STRING: 9606.ENSP00000324583

UniGene: Hs.553582

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification and functional role of OR2T12?

OR2T12 belongs to the G-protein coupled receptor 1 family. Like other olfactory receptors, it features a characteristic 7-transmembrane domain structure shared with many neurotransmitter and hormone receptors . The receptor functions by interacting with odorant molecules in the nasal cavity, initiating neuronal responses that trigger smell perception .

Methodologically, structural characterization requires:

  • Hydropathy plot analysis to confirm the 7-transmembrane structure

  • Homology modeling based on resolved GPCR structures

  • Sequence alignment with other olfactory receptors to identify conserved domains

How does OR2T12 compare to other olfactory receptors in terms of genomic organization?

The olfactory receptor gene family, which includes OR2T12, is the largest gene family in the human genome . The nomenclature assigned to these genes is organism-specific and independent of other species . While specific genomic location data for OR2T12 isn't provided in the search results, olfactory receptor genes typically organize in clusters across multiple chromosomes.

Research approaches to study genomic organization include:

  • Comparative genomic analysis across species

  • Regulatory element identification through ChIP-seq

  • Analysis of chromosomal clustering patterns

What methods are recommended for detecting endogenous versus recombinant OR2T12 expression?

Detection methods differ based on research objectives:

Detection MethodEndogenous ExpressionRecombinant ExpressionTechnical Considerations
RT-PCRSensitive for low-level expressionConfirms transcriptionRequires OR2T12-specific primers
Western BlotChallenging due to low natural expressionEffective with fusion tagsTag-specific antibodies provide higher specificity
ImmunohistochemistryRequires highly specific antibodiesCan utilize tag antibodiesFixation methods affect GPCR epitope accessibility
Flow CytometryLimited without specific antibodiesEffective with fluorescent tagsSurface expression quantification

What expression systems are most appropriate for functional OR2T12 studies?

Several expression systems are available for recombinant OR2T12 production, each with distinct advantages :

Expression SystemAdvantagesLimitationsBest Applications
E. coliCost-effective, high yieldLimited post-translational modificationsStructural studies, antibody production
YeastBetter folding than bacterial systemsGlycosylation patterns differ from mammalianModerate-scale functional studies
Mammalian (293T, CHO, etc.)Native-like post-translational modificationsHigher cost, lower yieldLigand screening, signaling studies
Insect CellGood compromise between yield and foldingIntermediate complexityStructural biology, protein-protein interactions

Selection should be based on experimental requirements for protein folding, post-translational modifications, and functional assays .

How do fusion tags affect OR2T12 structure-function relationships?

Different fusion tags serve various research purposes :

  • His Tag: Enables metal affinity chromatography purification with minimal size

  • FLAG Tag: Provides highly specific antibody detection

  • MBP/GST: Enhance solubility but may affect membrane insertion

  • GFP: Enables visualization of subcellular localization and expression levels

Tag positioning (N-terminal vs. C-terminal) should be carefully considered as it may interfere with receptor function, particularly since GPCRs have critical domains at both termini .

What purification strategies yield the highest quality OR2T12 for functional studies?

OR2T12 purification requires specialized approaches for membrane proteins:

  • Solubilization using appropriate detergents or nanodiscs

  • Affinity chromatography utilizing fusion tags (His, FLAG, etc.)

  • Size exclusion chromatography for final polishing

  • Protein renaturation if expression results in inclusion bodies

  • Endotoxin removal and sterile filtration for downstream applications

Quality control should include Western blotting, mass spectrometry, and circular dichroism to verify protein integrity.

What experimental design principles are essential when investigating OR2T12 function?

Robust experimental design for OR2T12 studies should include :

  • Clear hypothesis statements regarding OR2T12 ligand interactions or signaling

  • Independent variables (ligand concentration, structural variants)

  • Dependent variables (calcium flux, cAMP levels) that can be precisely measured

  • Appropriate controls (mock-transfected cells, inactive ligand analogs)

  • Sufficient replication to enable statistical analysis

True experimental designs are considered most accurate for establishing causal relationships in receptor function studies .

How can researchers effectively design ligand screening assays for OR2T12?

Ligand screening requires systematic approaches:

  • Begin with computational prediction of potential ligands based on homology to other characterized ORs

  • Use high-throughput calcium imaging or cAMP assays with dose-response testing

  • Implement counterscreens to eliminate false positives from non-specific cellular effects

  • Validate hits with orthogonal assays measuring different aspects of GPCR signaling

  • Compare activation profiles with structurally related ORs to establish specificity

Similar to techniques used for OR51E2, researchers should consider that ORs may respond to diverse chemical classes including fatty acids, terpenoids, and steroid hormones .

What methodological approaches reveal OR2T12 signaling pathway components?

To characterize OR2T12 signaling pathways:

  • G-protein coupling specificity determination using pathway-specific inhibitors

  • Calcium flux measurement with fluorescent indicators like Fura-2

  • cAMP quantification using FRET-based sensors or ELISA

  • Protein kinase activation profiling (PKA, MAPK) by phospho-specific antibodies

  • Transcriptional reporter assays for downstream gene activation

Based on knowledge from other ORs like OR51E2, signaling likely involves G-protein coupling leading to intracellular calcium elevation and cAMP production .

How should researchers approach studying epigenetic regulation of OR2T12 expression?

Based on what we know about olfactory receptor regulation, studying OR2T12 epigenetic control requires sophisticated methodologies :

  • ChIP-seq to identify transcription factor binding patterns, particularly focusing on Lhx2 and Ebf family factors that cooperatively regulate OR expression

  • ATAC-seq to assess chromatin accessibility around the OR2T12 locus in expressing versus non-expressing cells

  • Comparative analysis of enhancer elements ("Greek Islands") that may regulate OR2T12 through long-range interactions

  • Chromosome conformation capture techniques (4C/Hi-C) to identify interchromosomal hubs that may influence singular OR expression

  • Investigation of heterochromatic silencing mechanisms that normally repress most OR genes

Research indicates that transcription factors like Lhx2 and Ebf specify OR enhancers by binding to stereotypically spaced motifs that evade heterochromatin silencing .

What are the challenges in generating OR2T12 knockout models and how can they be addressed?

Creating OR2T12 knockout models presents several challenges:

  • Potential redundancy with other ORs may mask phenotypes

  • Cell-type specificity requires targeted approaches

  • The large size of the OR gene family complicates specific targeting

Methodological solutions include:

  • CRISPR-Cas9 with highly specific guide RNAs targeting unique OR2T12 sequences

  • Conditional knockout systems utilizing OSN-specific Cre drivers

  • Knock-in reporter strategies to monitor expression changes in the modified locus

  • Comprehensive behavioral phenotyping focusing on specific odor detection

What bioinformatic approaches best predict OR2T12 ligand specificity?

Advanced computational methods for ligand prediction include:

  • Homology modeling based on resolved GPCR structures

  • Molecular docking simulations with diverse chemical libraries

  • Machine learning algorithms trained on known OR-ligand pairs

  • Molecular dynamics simulations to assess binding stability

  • Quantitative structure-activity relationship (QSAR) models

These computational approaches should be validated through experimental testing, as structural predictions for GPCRs remain challenging.

What are common pitfalls in OR2T12 functional assays and how can they be overcome?

IssueCauseSolution
Low expression levelsCodon usage, toxicityCodon optimization, inducible expression systems
Poor membrane targetingImproper foldingUse rhodopsin or other GPCR tags, optimize signal peptides
Non-specific responsesEndogenous receptor activationUse receptor-null cell lines, include appropriate controls
Inconsistent activationVariable receptor densityNormalize responses to expression levels via fluorescent tags
Signal saturationExcessive stimulationEstablish full dose-response curves, optimize detection window

How should researchers interpret contradictory results from different OR2T12 expression systems?

When facing contradictory results:

  • Systematically compare expression levels across systems using quantitative Western blots

  • Verify proper folding and membrane insertion using surface biotinylation assays

  • Assess post-translational modification differences between expression systems

  • Consider cell-specific factors that may influence G-protein coupling efficiency

  • Examine the influence of membrane composition on receptor function

Reconciling contradictions often requires standardizing experimental conditions and validating findings across multiple systems.

What statistical approaches are most appropriate for analyzing OR2T12 ligand screening data?

Statistical analysis of OR2T12 screening data should include:

  • Normalization methods to account for variable expression levels

  • Dose-response curve fitting using non-linear regression

  • Calculation of EC50 values with confidence intervals

  • Multiple comparison corrections when screening large compound libraries

  • Principal component analysis for multiparametric response data

  • Hierarchical clustering to identify chemically similar activators

Robust statistical methods help distinguish true ligands from false positives and enable quantitative comparisons between different experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.