Recombinant Human Olfactory receptor 2T34 (OR2T34)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

OR2T34 belongs to the G-protein-coupled receptor (GPCR) family, specifically Class II olfactory receptors involved in odorant detection . The recombinant version replicates the native human protein (UniProt: Q8NGX1) and enables controlled experimental studies without requiring tissue extraction .

Key functional characteristics:

  • Ligand interaction: Binds odorants and psychoactive substances (e.g., ergot alkaloids, antidepressants) .

  • Signaling: Inhibits adenylate cyclase via G-protein coupling, modulating serotonin, dopamine, and acetylcholine release .

  • Pathways: Associated with neuroactive ligand-receptor interactions and cGMP-PKG signaling .

Research Applications

  • Ligand Screening: Identifies agonists/antagonists via binding assays .

  • Neurological Studies: Investigates serotonin-mediated mood regulation and pain perception pathways .

  • Structural Biology: Analyzes GPCR activation mechanisms using purified protein .

Analytical Performance

  • Reproducibility: Intra-assay CV <10%, inter-assay CV <12% (optimized protocols) .

  • Sensitivity: Detects endogenous OR2T34 in tissue homogenates at picomolar concentrations .

Limitations and Future Directions

  • Challenges: Low natural abundance in tissues complicates native protein isolation .

  • Opportunities: CRISPR-edited cell lines expressing OR2T34 could enhance drug discovery .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2T34; Olfactory receptor 2T34; Olfactory receptor OR1-63
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2T34
Target Protein Sequence
MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRL HTPMYFFISQLALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFHLTLAGAEVFLL AAMAYDRYAAVCRPLHYPLLMNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKIL SFFCETPALLKLSCSDVSLYKMLTYLCCILMLLTPIMVISSSYTLILHLIHRMNSAAGRR KALATCSSHMIIVLLLFGASFYTYMLRSSYHTAEQDMMVSAFYTIFTPVLNPLIYSLRNK DVTRALRSMMQSRMNQEK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 31256

KEGG: hsa:127068

STRING: 9606.ENSP00000330904

UniGene: Hs.553584

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of the OR2T34 gene?

OR2T34 is located on chromosome 1q44 and belongs to a cluster of olfactory receptor genes that includes OR2T10, OR2T11, and OR2T35 . This region has been identified as structurally variable in human populations, with evidence of deletion variants that can affect the entire locus. The gene encodes a G protein-coupled receptor that is part of the larger olfactory receptor family responsible for odor detection. Genomic studies have shown that OR2T34 and its neighboring genes span approximately 80.5 kb in the reference genome, forming a functional unit that may be affected by structural variation as a whole rather than individually . The structural architecture of this region suggests evolutionary mechanisms that have shaped the olfactory gene repertoire through duplication and deletion events throughout human history.

How does copy number variation affect OR2T34 expression and function?

Copy number variations (CNVs) of OR2T34 have been observed in human populations, with complete deletion of the locus occurring in some individuals . These variations likely contribute to functional differences in olfactory perception between individuals. In particular, a deletion encompassing OR2T34 along with OR2T10, OR2T11, and OR2T35 has been documented in specific genomes, including the Watson genome . The functional consequences of these deletions may include altered sensitivity to specific odorants that would normally activate these receptors. Research suggests that CNVs affecting olfactory receptor genes are common in humans and may underlie some of the variation in olfactory perception observed among individuals. Multiple analytical approaches, including microarray-based detection and quantitative PCR (qPCR), have been used to characterize these variations and their potential functional impacts on the olfactory system .

What methodological approaches are used to study OR2T34 gene variation?

Several complementary methodologies have been employed to study OR2T34 variation. High-resolution oligonucleotide tiling microarrays have been used to detect copy number variations across the olfactory receptor gene family, including OR2T34 . This approach allows for genome-wide screening of CNVs with relatively high sensitivity. Quantitative PCR (qPCR) serves as a validation method for CNV findings from microarray studies, providing more precise quantification of gene copy numbers in individual samples . Additionally, researchers employ PCR amplification followed by sequencing to identify specific polymorphisms within OR genes, though this approach is typically applied for detecting single nucleotide polymorphisms rather than larger structural variations . For detailed characterization of breakpoints in CNVs, computational algorithms like BreakPtr can analyze microarray data to predict the precise locations where structural variations begin and end, which is particularly valuable for understanding the mechanisms underlying olfactory receptor gene rearrangements .

What mechanisms drive the genomic instability observed at the OR2T34 locus?

The genomic instability at the OR2T34 locus appears to be driven by several molecular mechanisms that promote structural variation. Non-allelic homologous recombination (NAHR) has been identified as a key mechanism underlying copy number variations in olfactory receptor genes . This process occurs when highly similar sequences misalign during meiosis, leading to unequal crossing over and resultant duplications or deletions. The OR2T34 region contains inverted duplications of approximately 100 kb that can facilitate such rearrangements . These structural features create a genomic architecture that is prone to recombination events. The evolutionary history of olfactory receptor genes suggests that both homology-based and homology-independent processes have contributed to remodeling the OR gene family throughout human evolution and continue to generate inter-individual variation . Research indicates that the mechanisms responsible for the diversification of the OR family over evolutionary time scales are still active today, leading to the polymorphic nature of genes like OR2T34 in modern human populations.

How can researchers effectively design experiments to validate the functional consequences of OR2T34 variants?

Validating the functional consequences of OR2T34 variants requires a multi-faceted experimental approach. In vitro expression systems using heterologous cells such as Hana3A cells (which are optimized for olfactory receptor expression) can be employed to express different variants of OR2T34 and assess their cell surface localization through immunofluorescence techniques . These systems allow for comparison of wild-type and variant receptors under controlled conditions. Calcium imaging or cAMP assays can then be used to measure receptor activation in response to potential ligands, revealing functional differences between receptor variants. For in vivo validation, researchers might consider recruiting human subjects with different OR2T34 genotypes for odor perception tests, similar to approaches used for other olfactory receptors . This requires careful experimental design with standardized odor presentation methods and robust statistical analysis to account for the subjective nature of olfactory perception. Finally, CRISPR-Cas9 gene editing in model organisms could be employed to recapitulate human variants and study their effects on olfactory function in a controlled genetic background, though the species-specific nature of olfactory receptors presents challenges for translating these findings to human perception.

What are the challenges in producing functional recombinant OR2T34 for research purposes?

Production of functional recombinant olfactory receptors, including OR2T34, presents several significant challenges for researchers. Olfactory receptors are seven-transmembrane G protein-coupled receptors that often express poorly in heterologous systems due to misfolding and retention in the endoplasmic reticulum . To overcome these challenges, researchers typically employ specialized expression systems, such as Hana3A cells, which co-express accessory factors that facilitate receptor trafficking to the cell membrane. Even with these systems, protein yields can be low, necessitating optimization of expression conditions and potentially the addition of N-terminal tags (such as rhodopsin tags) that can enhance surface expression . Another significant challenge is maintaining the native conformation of the receptor during purification, as detergent solubilization can disrupt the protein structure. Cell-free expression systems represent an alternative approach that may circumvent some of these difficulties, as they have been successfully employed for other olfactory receptors like OR5AL1 . Despite these advances, functional validation remains challenging due to the orphan status of many olfactory receptors, including OR2T34, for which specific ligands have not yet been identified.

What detection methods provide the most reliable results for OR2T34 copy number analysis?

MethodSensitivitySpecificityThroughputCostBest Use Case
Oligonucleotide MicroarraysModerate-HighModerateHighModerateInitial genome-wide screening
qPCRHighHighLowLowValidation of specific loci
Long-read SequencingVery HighHighLowHighDetailed breakpoint characterization
MLPAHighHighModerateLowTargeted analysis of multiple loci

What experimental controls are essential when analyzing OR2T34 expression and function?

Rigorous experimental controls are essential for reliable analysis of OR2T34 expression and function. When conducting gene expression studies, researchers should include housekeeping genes with stable expression across tissues and conditions as internal controls for normalization . For copy number variation analysis, including control genes known to have stable copy numbers across populations provides crucial reference points . When expressing recombinant OR2T34 in heterologous systems, empty vector transfections serve as negative controls, while well-characterized olfactory receptors with known expression patterns and ligands can function as positive controls . For immunodetection of OR2T34 protein, specificity controls such as peptide competition assays or knockout/knockdown validation can confirm antibody specificity. In functional assays, mock-transfected cells establish baseline responses, while dose-response curves with known olfactory receptor ligands validate assay functionality. If conducting studies in human subjects, careful screening for confounding factors such as smoking status, recent upper respiratory infections, or medications that might affect olfactory function is necessary . Additionally, repeat testing of subjects on different days can control for day-to-day variations in olfactory perception, as practiced in previous olfactory receptor studies .

How might OR2T34 research contribute to understanding human olfactory perception diversity?

Research on OR2T34 variation offers significant potential for understanding diversity in human olfactory perception. The documented copy number variation of OR2T34 likely contributes to phenotypic differences in odor detection capabilities among individuals . Since approximately 28% of olfactory receptor genes show copy number variation in human populations, genes like OR2T34 represent important models for understanding how genetic diversity translates to perceptual differences . Future research could connect specific OR2T34 variants with differences in detection thresholds, intensity perception, or quality descriptors for particular odorants, similar to work done with other olfactory receptors like OR7D4 . Such genotype-phenotype correlations could help explain why individuals perceive certain odors differently, with potential applications in personalized approaches to contexts where olfactory perception is important. Additionally, understanding the evolutionary patterns of OR2T34 variation could provide insights into selection pressures that have shaped human olfactory perception throughout history. The complex genomic architecture of the OR2T34 region, with evidence of recurrent duplication and deletion events, suggests an evolutionary history worth exploring in relation to environmental adaptations and human migration patterns .

What collaborative approaches between genomics and neuroscience can advance OR2T34 research?

Advancing OR2T34 research requires collaborative approaches that bridge genomics and neuroscience. Integrating high-throughput genomic analyses of OR2T34 variants with functional neuroscience studies of olfactory perception can establish clearer genotype-phenotype relationships. This could involve recruiting subjects with known OR2T34 genotypes for detailed psychophysical testing, olfactory event-related potentials, or functional neuroimaging during odor presentation . Computational modeling approaches could predict the structural consequences of OR2T34 variations and their potential impact on ligand binding, generating hypotheses that can be tested experimentally. Single-cell RNA sequencing of olfactory sensory neurons could reveal expression patterns of OR2T34 variants in the nasal epithelium and characterize any co-expression with other receptors, providing insights into the cellular basis of olfactory coding. Systems biology approaches that consider the entire olfactory receptor repertoire, including OR2T34, could reveal patterns of co-variation that might indicate functional redundancy or complementarity among receptors. Finally, population genetics studies across diverse human groups could reveal whether OR2T34 variants show any signatures of selection that might indicate adaptive significance in different environmental or cultural contexts. Such collaborative research would build a more comprehensive understanding of how genetic variation in OR2T34 contributes to the complex and highly personal nature of olfactory perception.

How can researchers overcome difficulties in detecting low-frequency OR2T34 variants?

Detecting low-frequency OR2T34 variants presents several challenges that researchers can address through methodological refinements. Increasing sample size is a fundamental approach, as studies with larger cohorts have greater statistical power to detect rare variants . The research indicates that some OR variants may be present in as few as 1% of individuals, necessitating substantial sample sizes for reliable detection . Employing multiple complementary detection methods can enhance sensitivity, as exemplified by studies that identified OR variants using microarrays but also captured additional variants through qPCR that were missed by array-based methods . Deep sequencing approaches with high coverage can improve detection of rare variants, while long-read sequencing technologies may better resolve complex structural variations. Careful selection of reference samples is also critical, as research has shown that the choice of reference individual can influence the apparent pattern of gains and losses in olfactory receptor genes . Using population-specific references rather than the standard reference genome may be more appropriate when studying specific populations. Finally, sophisticated computational approaches for variant calling that are specifically tuned for the repetitive genomic contexts found in olfactory receptor gene regions can improve detection accuracy for low-frequency variants in these challenging regions.

What strategies help ensure reproducibility in OR2T34 functional studies?

Ensuring reproducibility in OR2T34 functional studies requires meticulous attention to methodological details and robust experimental design. Standardization of experimental protocols is essential, including consistent cell culture conditions, transfection procedures, and assay parameters across experiments and between laboratories . Detailed reporting of all methodological aspects facilitates replication, including specific reagents, cell lines, DNA constructs, and equipment settings. Researchers should implement rigorous quality control measures, such as verification of receptor expression through Western blotting or fluorescence microscopy before functional assays are conducted . Using multiple functional readouts (e.g., calcium imaging, cAMP accumulation, and receptor internalization) provides convergent evidence for receptor activation and reduces the risk of assay-specific artifacts. Appropriate statistical analysis with pre-determined sample sizes based on power calculations helps ensure that observed effects are robust. Blinding experimenters to sample identity whenever possible reduces the risk of unconscious bias in data collection and analysis. Replication across independent experiments, ideally in different laboratories, provides the strongest evidence for reproducibility. Finally, researchers should consider testing OR2T34 variants in multiple expression systems, as receptor function can sometimes be influenced by the cellular background in which it is expressed, particularly for olfactory receptors which often require specific accessory factors for proper function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.