Recombinant Human Olfactory receptor 2T3 (OR2T3)

Shipped with Ice Packs
In Stock

Description

Introduction to OR2T3

OR2T3 belongs to the class A rhodopsin-like G protein-coupled receptor (GPCR) family . It is encoded by the OR2T3 gene located on human chromosome 1 and is categorized under the odorant receptor family 2, subfamily T . Unlike canonical olfactory receptors in nasal neurons, OR2T3 exhibits ectopic expression in non-olfactory tissues, including immune cells and reproductive systems .

Expression Systems and Production

Recombinant OR2T3 is produced in heterologous systems for research:

SystemHostTagPurityApplications
YeastSaccharomycesRho-1D4 tag>85%Calcium imaging, ligand screens
MammalianHEK293/Hana3ANone/Rho-tag>90%Functional assays

These systems enable large-scale production while preserving ligand-binding specificity .

Immune Modulation

OR2T3 activation in leukocytes triggers:

  • Ca²⁺ influx via adenylate cyclase-cAMP pathways

  • Chemotaxis regulation in neutrophils and T cells

Reproductive Roles

In human spermatozoa, OR2T3 localizes to the flagellum and may influence motility through odorant-mediated signaling .

Cancer Relevance

Ectopic OR2T3 expression correlates with:

  • Reduced proliferation in acute myeloid leukemia via cell cycle arrest

  • Apoptosis induction in tumor cells

Research Applications

Study TypeKey FindingsCitations
Ligand screeningOR2T3 responds to synthetic odorants (e.g., helional) at EC₅₀ ~10⁻⁶ M
Structural analysisTM3 and ECL2 domains critical for ligand specificity
Pathological assaysOR2T3 knockdown accelerates cancer cell migration in vitro

Future Directions

  • Deorphanization: Identifying endogenous ligands beyond synthetic odorants .

  • Therapeutic targeting: Exploiting OR2T3’s role in cancer and immune modulation .

  • Structural studies: Cryo-EM analysis to resolve activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
OR2T3; Olfactory receptor 2T3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2T3
Target Protein Sequence
MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRL HTPMYFFISQLALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFYLTLAGAEVFLL AAMAYDRYAAVCRPLHYPLLMNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKIL SFFCETPALLKLSCSDVSLYKTLMYLCCILMLLAPIMVISSSYTLILHLIHRMNSAAGHR KALATCSSHMIIVLLLFGASFYTYMLPSSYHTAEQDMMVSAFYTIFTPVLNPLIYSLRNK DVTRALRSMMQSRMNQEK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14727

KEGG: hsa:343173

STRING: 9606.ENSP00000352604

UniGene: Hs.554481

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR2T3 and what is its role in the human olfactory system?

OR2T3 is a member of the large family of G protein-coupled receptors (GPCRs) expressed in olfactory sensory neurons in the nasal epithelium. Like other olfactory receptors, OR2T3 is involved in the initial detection of odorant molecules, triggering signal transduction cascades that ultimately lead to odor perception.

The olfactory system employs a combinatorial coding strategy where individual odorants activate multiple receptors, and each receptor responds to multiple odorants with varying efficacies. This creates unique activation patterns that the brain interprets as distinct odors . Studies of specific receptors like OR2T3 help decode this complex system and enhance our understanding of olfactory perception mechanisms.

How does OR2T3 compare structurally to other characterized human olfactory receptors?

OR2T3 shares the characteristic seven-transmembrane domain structure common to class A GPCRs. Among the approximately 400 intact human olfactory receptors, OR2T3 belongs to the OR2 family, which includes other receptors like OR2J2 and OR2J3 .

Sequence analysis reveals that OR2T3, like other ORs, contains conserved motifs in transmembrane regions that are crucial for proper protein folding and function. Variability in the binding pocket region likely contributes to its specific odorant recognition profile. While the three-dimensional structure of OR2T3 has not been experimentally determined (as is the case for most ORs), homology modeling based on related GPCRs can provide insights into its structural features .

What are the known ligands for OR2T3 based on current research?

Current research on OR2T3 ligand specificity is limited compared to better-characterized ORs such as OR2J3 and OR2W1. Based on screening methodologies similar to those used for other ORs, researchers investigate potential ligands through heterologous expression systems coupled with functional assays.

To date, comprehensive screening approaches similar to those employed in the study by Mainland et al. would be required to definitively identify OR2T3 ligands . Such screens typically test ORs against panels of diverse odorants at multiple concentrations, seeking to identify compounds that elicit dose-dependent responses. For researchers interested in OR2T3 ligand identification, adopting methodologies that have successfully deorphanized other receptors would be advisable.

What expression systems are most effective for recombinant OR2T3 functional studies?

Based on established protocols for olfactory receptor research, the most effective expression systems for OR2T3 functional studies include:

Expression SystemAdvantagesLimitationsRecommended Applications
Hana3A cellsExpresses RTP1S and other accessory proteins; well-established for OR functional assaysMay not perfectly recapitulate native neuronal environmentLigand screening, dose-response studies
HEK293T cellsWidely available, easily transfectableLower surface expression without accessory proteinsStructure-function studies with RTP1S co-expression
Xenopus oocytesAllows electrophysiological recordingsLabor-intensiveDetailed characterization of channel properties
Native olfactory neuronsPhysiologically relevantTechnically challenging, limited throughputValidation of findings from heterologous systems

For optimal surface expression and functionality, co-transfection with receptor-transporting proteins (RTPs), particularly RTP1S, is crucial as demonstrated in studies with other ORs . The Hana3A cell line, which stably expresses RTP1S and other accessory factors, provides an excellent platform for initial functional characterization of OR2T3.

What are the recommended methods for measuring OR2T3 activation in vitro?

Several complementary methods can be employed to measure OR2T3 activation:

  • Luciferase reporter assays: These assays couple receptor activation to cAMP-dependent luciferase expression and represent the gold standard for high-throughput screening. The Dual-Glo Luciferase Assay System has been successfully employed for numerous ORs and allows for normalization to control for transfection efficiency variations .

  • Calcium imaging: Fluorescent calcium indicators can measure intracellular calcium mobilization following receptor activation, allowing for real-time visualization of responses.

  • cAMP accumulation assays: Direct measurement of cAMP production using ELISA or other cAMP-specific assays provides quantitative data on receptor activation.

  • Electrophysiology: Patch-clamp recordings in heterologous systems or olfactory neurons provide detailed information about channel kinetics and response characteristics.

When designing functional assays for OR2T3, researchers should consider using multiple concentrations of test compounds (typically ranging from 10 nM to 10 mM) to generate complete dose-response curves . This approach allows for determination of key pharmacological parameters such as EC50 values and efficacy.

How can one optimize the cloning and expression of recombinant OR2T3?

Optimizing OR2T3 cloning and expression requires attention to several critical factors:

  • Sequence verification: The open reading frame should be amplified from genomic DNA using high-fidelity polymerase and thoroughly sequenced to ensure no mutations are introduced during cloning .

  • Expression vector selection: Vectors containing strong promoters (e.g., CMV) and appropriate tags for detection and trafficking are recommended. The addition of the first 20 amino acids of rhodopsin (Rho tag) to the N-terminus significantly improves surface expression of ORs .

  • Codon optimization: Adapting the OR2T3 sequence to the codon usage of the expression system can enhance protein yields.

  • Co-expression with accessory proteins: RTP1S, REEP1, and Gαolf co-transfection dramatically improves functional expression levels .

  • Transfection optimization: For transient transfection, optimizing DNA ratios (typically 5-10 ng/well of OR plasmid for 96-well formats) and using high-efficiency reagents ensures consistent expression .

A recommended transfection mixture for a standard luciferase assay includes 5 ng/well of RTP1S, 5 ng/well of pRL-SV40, 10 ng/well of CRE-luciferase, 2.5 ng/well of M3, and 5 ng/well of the OR2T3 plasmid .

How should dose-response data for OR2T3 activation be analyzed and interpreted?

Proper analysis of dose-response data for OR2T3 involves several key steps:

  • Normalization: Raw luminescence or fluorescence values should be normalized to control for transfection efficiency variations. For luciferase assays, dividing firefly luciferase activity by Renilla luciferase activity is standard practice .

  • Baseline subtraction: Responses should be corrected by subtracting baseline values (cells transfected with empty vector or unstimulated cells) .

  • Curve fitting: Normalized data should be fitted to a sigmoidal dose-response curve using nonlinear regression. The four-parameter logistic equation is commonly used:
    Y=Bottom+TopBottom1+10(LogEC50X)×HillSlopeY = Bottom + \frac{Top - Bottom}{1 + 10^{(LogEC_{50} - X) \times HillSlope}}

  • Parameter extraction: Key parameters to determine include:

    • EC50: The concentration producing 50% of maximal response

    • Hill coefficient: Indicates cooperativity in binding

    • Top and bottom plateaus: Represent maximal effect and baseline

  • Statistical validation: An odorant should be considered an agonist only if:

    • The 95% confidence intervals of top and bottom parameters do not overlap

    • The standard deviation of the fitted log EC50 is less than 1 log unit

    • Statistical tests (e.g., extra sum-of-squares F test) confirm significant activation compared to vector-only controls

When comparing multiple ligands, researchers should present complete dose-response curves rather than single-point measurements to provide insights into both potency and efficacy differences.

What are the common challenges in interpreting OR2T3 genetic variation data?

Analyzing genetic variation in OR2T3 presents several challenges that must be addressed methodically:

  • Distinguishing functional from non-functional variants: Not all genetic variations impact receptor function. Missense mutations in binding pockets or G-protein coupling domains are more likely to affect function than variations in less conserved regions .

  • Determining haplotype effects: Individual SNPs may have limited effects, but combinations of variants (haplotypes) can significantly alter receptor function. Complete haplotype reconstruction is essential for accurate interpretation .

  • Assessing in vitro vs. in vivo relevance: Variations that affect function in heterologous systems may not have equivalent impacts on perception due to the redundancy in the olfactory system .

  • Population stratification: Allele frequencies can vary significantly between ethnic groups, necessitating careful population matching in association studies .

  • Technical variability: Standardization of experimental conditions is crucial, as receptor responses can vary between assays and expression systems .

When investigating OR2T3 variants, researchers should sequence the full coding region to identify all variants, test multiple haplotypes rather than individual SNPs, and correlate findings with perceptual data when possible .

How can OR2T3 structure-function relationships be systematically investigated?

A comprehensive approach to OR2T3 structure-function analysis incorporates:

  • Site-directed mutagenesis: Systematic mutation of conserved and variable residues, particularly those in predicted binding pockets, can identify amino acids crucial for ligand recognition and activation . Key targets include:

    • Transmembrane domains 3, 5, and 6, which often form the binding pocket

    • The DRY motif involved in G-protein coupling

    • N-terminal glycosylation sites that may affect trafficking

  • Chimeric receptor construction: Creating chimeras between OR2T3 and functionally characterized receptors (like OR2J3) can help identify domains responsible for specific response properties .

  • Molecular dynamics simulations: In silico modeling of OR2T3-ligand interactions can generate testable hypotheses about binding mechanisms.

  • Correlation of natural variants with function: Analyzing how naturally occurring polymorphisms affect receptor function provides insights into structure-function relationships within evolutionary constraints .

A suggested experimental workflow involves:

  • Creating a suite of point mutations and chimeric constructs

  • Expressing each variant in a standardized system

  • Testing response profiles to a panel of structurally diverse odorants

  • Mapping functional changes to the receptor's structural model

This approach has successfully identified key determinants of ligand specificity in receptors like OR2J3, where amino acid substitutions T113A and R226Q significantly impacted response to cis-3-hexen-1-ol .

What approaches can be used to integrate OR2T3 functional data with broader olfactory coding principles?

Integrating OR2T3 functional data with broader olfactory coding principles requires multilevel analysis:

  • Comparative receptor profiling: Testing OR2T3 alongside other ORs against the same odorant panel allows placement within the larger receptor response space . This reveals whether OR2T3 detects unique molecular features or overlaps with other receptors.

  • Bioinformatic analysis of receptor clusters: OR2T3 should be analyzed in the context of phylogenetically related receptors to identify functional patterns within receptor families .

  • Network analysis of receptor-ligand interactions: Using databases like M2OR (Molecule to Olfactory Receptor), researchers can map OR2T3's position within the complex network of receptor-odorant interactions .

  • Integration with perceptual data: Correlating OR2T3 activation patterns with human psychophysical data helps bridge molecular mechanisms and perceptual outcomes .

  • Systems-level modeling: Developing computational models that incorporate OR2T3 data allows prediction of activation patterns for novel compounds and exploration of coding principles.

This integrated approach helps address fundamental questions about how the olfactory system encodes chemical information and how individual receptors like OR2T3 contribute to the combinatorial code of odor perception .

How does genetic variation in OR2T3 potentially impact olfactory perception at the population level?

Genetic variation in OR2T3 likely contributes to perceptual diversity across populations through several mechanisms:

  • Altered sensitivity thresholds: As demonstrated with OR2J3 and cis-3-hexen-1-ol, specific haplotypes can explain significant variation in detection thresholds for particular odorants . For OR2T3, similar variations could impact detection of its cognate ligands.

  • Functional polymorphisms: Nonsynonymous SNPs that alter amino acid sequence, particularly in binding pockets, can modify receptor function. Functional testing of OR2T3 variants would reveal which polymorphisms impact response properties .

  • Population-specific variations: Different human populations show distinct patterns of genetic variation in ORs, suggesting adaptation to diverse chemical environments or dietary preferences .

  • Combinatorial effects: Since olfactory perception depends on activation patterns across many receptors, variation in OR2T3 must be considered in the context of an individual's full OR genotype.

Researchers investigating this question should consider employing genome-wide association studies (GWAS) paired with detailed phenotyping of olfactory perception, similar to approaches that successfully linked OR2J3 variants to perceptual differences . When analyzing such data, it's important to account for linkage disequilibrium within the OR gene cluster, as OR2T3 is located in a region containing multiple OR genes.

What high-throughput approaches can accelerate OR2T3 ligand discovery?

Several cutting-edge approaches can facilitate efficient OR2T3 ligand discovery:

  • Multiplexed screening platforms: Systems that simultaneously test multiple concentrations and compounds significantly increase throughput. The approach used by Mainland et al., screening 73 odorants against 511 ORs, exemplifies this strategy .

  • Machine learning-based virtual screening: Computational models trained on known OR-ligand pairs can predict potential OR2T3 agonists for prioritized testing .

  • Cheminformatic analysis of OR2T3 relationships: Leveraging databases like M2OR allows researchers to identify ligands for phylogenetically related receptors as candidates for OR2T3 .

  • Automated image-based screening: High-content imaging systems coupled with fluorescent calcium indicators or membrane potential dyes can monitor responses in thousands of cells simultaneously.

  • Reporter cell line development: Creating stable cell lines expressing OR2T3 and appropriate reporters eliminates transfection variability and enables more consistent high-throughput screening .

For optimal efficiency, a staged approach is recommended:

  • Initial broad screening at single concentrations (100 μM) against diverse chemical libraries

  • Secondary validation of hits at multiple concentrations (1, 10, 100 μM)

  • Detailed dose-response analysis (10 nM to 10 mM) for confirmed hits

This tiered strategy balances breadth of chemical space exploration with depth of characterization for promising compounds.

How can contradictory functional data for OR2T3 from different assay systems be reconciled?

Resolving contradictory OR2T3 functional data requires systematic investigation of assay-dependent variables:

  • Assay system comparison: Different heterologous systems (Hana3A cells, HEK293 cells, etc.) may yield varying results due to differences in accessory protein expression or signaling machinery. Side-by-side testing in multiple systems is essential for reconciliation .

  • Signal transduction pathway analysis: ORs can couple to different G-proteins and activate multiple downstream pathways. Monitoring several readouts (cAMP, calcium, β-arrestin recruitment) may reveal pathway-specific responses .

  • Expression level normalization: Surface expression levels significantly impact functional responses. Quantifying receptor expression through flow cytometry or surface biotinylation allows normalization of functional data .

  • Systematic analysis of experimental variables:

    • Cell density and passage number

    • Transfection efficiency and DNA quality

    • Assay timing and temperature

    • Odorant preparation and solubility

  • Statistical meta-analysis: When multiple datasets exist, formal meta-analysis techniques can identify consistent trends and outliers.

As noted in the literature, assay-dependent bias is a recognized phenomenon in OR research. A recent demonstration showed "new ligands for ORs were successfully identified in human prostate carcinoma cell lines (LNCaP), whereas they were not recognized when ORs were expressed in HEK293 cells" . This highlights the importance of validating findings across multiple systems.

What are the latest innovations in studying OR2T3 in its native cellular environment?

Recent technological advances have expanded capabilities for studying OR2T3 in its native context:

  • Single-cell RNA sequencing: This approach enables identification of cells expressing OR2T3 in the olfactory epithelium and characterization of their transcriptional profiles.

  • In vivo calcium imaging: Using genetically encoded calcium indicators expressed under OR2T3-specific promoters allows visualization of receptor activation in living olfactory sensory neurons.

  • CRISPR-based genome editing: Generation of OR2T3 knockout or reporter knock-in models provides powerful tools for studying receptor function in vivo.

  • Ex vivo tissue culture systems: Olfactory epithelium organoids or explant cultures maintain the native cellular environment while allowing controlled experimental manipulation.

  • Primary olfactory sensory neuron isolation: Techniques for isolating and maintaining primary neurons expressing specific ORs enable direct functional studies in the native cellular context.

These approaches complement heterologous expression systems by providing insights into how OR2T3 functions within the complete neuronal environment, including the influence of olfactory-specific factors that may be absent in recombinant systems. Researchers investigating OR2T3 should consider employing both artificial expression systems for detailed mechanistic studies and native context approaches for physiological relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.