Recombinant Human Olfactory receptor 2T6 (OR2T6)

Shipped with Ice Packs
In Stock

Description

Clinical Correlations

Data from OR2T6 expression studies in breast cancer cohorts .

Molecular Mechanisms

OR2T6 drives oncogenic processes via:

  1. Epithelial-Mesenchymal Transition (EMT):

    • Upregulation: Vimentin, N-cadherin, β-catenin .

    • Downregulation: E-cadherin .

  2. MAPK/ERK Signaling Activation:

    • Initiates phosphorylation cascades promoting proliferation and survival .

  3. Apoptosis Inhibition:

    • Reduces caspase activity, enhancing tumor cell viability .

5. Experimental Models and Research Applications
Recombinant OR2T6 is utilized in:

  • Cell Culture Studies: Overexpression in MCF-7 and MDA-MB-231 breast cancer cell lines to model cancer progression .

  • Signaling Pathway Analysis: Western blotting and qRT-PCR to evaluate MAPK/ERK activation .

  • Therapeutic Targeting: Potential for OR2T6 inhibitors in precision oncology .

6. Challenges and Future Directions
While OR2T6 shows promise as a cancer biomarker, limitations include:

  • Ligand Identification: No confirmed endogenous or synthetic ligands reported .

  • Heterogeneity: Variable expression in breast cancer subtypes requires further stratification .

  • Mechanistic Complexity: Interplay with non-canonical signaling pathways (e.g., TRPV6 channels) warrants deeper investigation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2T6; OR2T6P; OR2T9; Olfactory receptor 2T6; OST703; Olfactory receptor 2T9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR2T6
Target Protein Sequence
MNENNETLTRGFTLMGLFTHNKCSGFFFGVICAVFFMAMIANGVMIFLINIDPHLHTPMY FLLSHLSVIDTLYISTIVPKMLVDYLMGEGTISFIACTAQCFLYMGFMGAEFFLLGLMAY DRYVAICNPLRYPVLISWRVCWMILASSWFGGALDSFLLTPITMSLPFCASHQINHFFCE APTMLRLACGDKTTYETVMYVCCVAMLLIPFSVVTASYTRILITVHQMTSAEGRKKAFAT CSSHMMVVTLFYGAALYTYTLPQSYHTPIKDKVFSAFYTILTPLLNPLIYSLRNRDVMGA LKRVVARC
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15018

KEGG: hsa:254879

STRING: 9606.ENSP00000347965

UniGene: Hs.626884

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and classification of OR2T6?

OR2T6 (olfactory receptor family 2, subfamily T, member 6) belongs to the G protein-coupled receptor (GPCR) family, which comprises approximately 49% of all GPCRs . Like other olfactory receptors, OR2T6 features the characteristic seven-transmembrane domain structure. As a member of the GPCR superfamily, it signals through G protein-mediated pathways, particularly through olfactory-specific G protein α GNAL/Gαolf, which has high affinity for olfactory receptors . When studying the structure-function relationship of OR2T6, researchers should consider its membrane topology and ligand-binding domains, which are critical for its activation and signaling capabilities.

What expression systems are most effective for recombinant OR2T6 production?

For effective recombinant OR2T6 expression, human embryonic kidney-derived HEK293 cells with introduced chaperones have shown significant success. The Hana3A cell system, which incorporates receptor-transporting proteins (RTP1, RTP2) and receptor expression-enhancing protein 1 (REEP1), greatly improves cell surface expression of olfactory receptors . For OR2T6 specifically, researchers should consider:

  • Adding an N-terminal Rho-tag (rhodopsin-derived signal peptide) to enhance membrane localization

  • Using RTP1S (a C-terminal shortened version of RTP1) which more strongly improves surface expression

  • Testing alternative tags such as Lucy-tag or IL-6-Halo-tag, which enable surface expression of a wider range of ORs compared to Rho-tag alone

  • Co-expressing non-OR GPCRs (e.g., β2-adrenergic receptor, M3 muscarinic acetylcholine receptor) which can form heterodimers with ORs and improve their sorting to the cell surface

How do researchers verify successful expression of recombinant OR2T6?

Verification of successful OR2T6 expression requires multiple approaches:

  • Protein detection methods: Western blotting with specific antibodies against OR2T6 or against epitope tags (if the recombinant protein contains them)

  • Surface expression verification: Immunocytochemistry without permeabilization to confirm membrane localization

  • Functional verification: Calcium imaging assays to detect receptor activation in response to potential ligands

  • mRNA validation: Real-time quantitative PCR to confirm transcript expression levels, as performed in studies comparing normal versus cancerous tissues

For accurate quantification in tissue samples, researchers have successfully employed IHC methods that detect cytoplasmic OR2T6, which revealed significant expression differences between normal breast tissues (where expression was undetectable) and breast cancer samples (where 27.45% showed positive expression) .

What is the significance of OR2T6 expression in breast cancer?

OR2T6 is significantly overexpressed in breast cancer tissues compared to normal breast tissues, making it a potential biomarker and therapeutic target . Research findings demonstrate:

  • Real-time quantitative PCR analysis shows significantly higher OR2T6 mRNA levels in breast cancer tissues (n=41) compared to normal breast tissues (n=9)

  • Immunohistochemistry studies found undetectable OR2T6 protein in normal breast tissues (n=60), while 27.45% (28/102) of breast cancer tissues showed positive cytoplasmic expression

  • OR2T6 expression correlates with clinicopathological features including lymph node metastasis and TNM staging

Clinicopathological FeatureOR2T6 PositiveOR2T6 NegativeP value
Lymph node metastasis0.002
No642
Yes2232
TNM staging0.033
I420
II1342
III59
IV63

This expression profile suggests OR2T6 plays a role in breast cancer progression and could serve as a prognostic marker .

How does OR2T6 influence survival outcomes in breast cancer patients?

Kaplan-Meier survival analyses reveal that breast cancer patients with OR2T6 expression have significantly poorer outcomes:

What molecular mechanisms underlie OR2T6's role in cancer progression?

OR2T6 promotes cancer progression through several key mechanisms:

  • Enhanced proliferation: EdU staining assays demonstrate that OR2T6 overexpression increases the percentage of proliferating breast cancer cells (MCF-7 and MDA-MB-231), while OR2T6 knockdown reduces proliferation

  • Inhibition of apoptosis: Flow cytometry analyses reveal that OR2T6 overexpression reduces the percentage of apoptotic cells (from 29.0% to 16.5% in MCF-7 cells), while OR2T6 knockdown increases apoptosis (from 5.4% to 17.6%)

  • EMT-mediated MAPK pathway activation: OR2T6 is associated with the epithelial-mesenchymal transition pathway, promoting cancer cell invasion and migration through MAPK signaling

These functional studies provide strong evidence that OR2T6 acts as a pro-oncogenic factor by promoting cell proliferation and survival while enhancing invasive capabilities.

What methodologies are most effective for identifying OR2T6 ligands?

Identifying ligands for orphan receptors like OR2T6 requires specialized approaches:

  • Surface Plasmon Resonance (SPR)-based screening: This label-free technique allows direct detection of protein-ligand interactions and is valuable for high-throughput screening of potential ligands . The methodology involves:

    • Immobilizing OR2T6-expressing whole cells (primary screening)

    • Using OR2T6 membrane fragments (secondary screening)

    • Measuring binding kinetics and affinity of small molecules, peptides, and proteins to the receptor

  • Calcium imaging in OR-expressing cells: After identifying potential ligands, calcium imaging in OR2T6-expressing cells (such as Hana3A cells) can verify functional activation and classify compounds as agonists or antagonists . This approach measures intracellular Ca²⁺ influx in real time, mimicking physiological receptor activation .

  • Cell-based functional assays: Following ligand identification, researchers should conduct viability and live/dead assays to determine biological responses to receptor activation or inhibition .

A combined approach using these methodologies provides comprehensive characterization of ligand-receptor interactions and functional consequences.

What are the challenges in measuring real-time OR2T6 responses and how can they be overcome?

Real-time measurement of OR2T6 responses presents several challenges:

  • Avoiding prolonged odor exposure: Continuous exposure of odors to OR-expressing cells for extended periods (30 min to several days) should be avoided as some compounds denature at room temperature or become cytotoxic, altering receptor responses

  • Mimicking physiological responses: Human olfaction responds immediately after odor stimulation and adapts within minutes, making real-time measurement critical

  • Measurement methodology limitations: While measuring OSN action potential changes would be optimal, it's challenging to measure membrane potential changes in many OR-expressing cells simultaneously

To overcome these challenges, researchers should:

  • Employ intracellular Ca²⁺ influx measurement in real time, as CNG (cyclic nucleotide-activated channel) induces membrane potential changes by mobilizing Ca²⁺ ions into cells

  • Use highly sensitive luciferase for cAMP detection, such as GloSensor™

  • Co-express olfactory-specific G protein α GNAL/Gαolf and the chaperone Ric-8B to enhance signal transduction

  • Develop specialized cell array sensors for comprehensive real-time responses to various molecules simultaneously

How can researchers effectively modulate OR2T6 expression for functional studies?

For functional characterization of OR2T6, researchers need reliable methods to modulate its expression:

  • Overexpression strategies:

    • Transfection of expression vectors containing OR2T6 cDNA with appropriate tags (Rho, Lucy, or IL-6-Halo) into cell lines like MCF-7 or MDA-MB-231

    • Co-transfection with chaperones (RTP1, RTP2, REEP1) to enhance surface expression

    • Selection of stable cell lines for consistent expression levels

  • Knockdown/silencing approaches:

    • siRNA-mediated gene silencing for transient knockdown

    • shRNA or CRISPR-Cas9 for stable gene knockdown or knockout

    • Validation of knockdown efficiency by qPCR and western blotting

  • Functional validation:

    • EdU staining to assess proliferation effects

    • Flow cytometry for apoptosis analysis

    • Migration and invasion assays to evaluate metastatic potential

Studies in breast cancer cell lines demonstrate the effectiveness of these approaches, showing clear phenotypic differences between OR2T6-overexpressing, normal, and OR2T6-knockdown cells .

How can OR2T6 be leveraged as a potential therapeutic target in cancer?

OR2T6's role in cancer progression suggests several therapeutic strategies:

  • Antagonist development: Identifying compounds that bind to OR2T6 and block its activity could inhibit cancer progression. For example, in studies of other ORs, rutin was identified as an antagonist that inhibited cell death induced by agonists

  • Agonist-induced cytotoxicity: Some OR agonists, like anthraquinone (AQ) for OR6M1, induce death of cancer cells, suggesting a similar approach could be explored for OR2T6

  • Targeted delivery systems: Developing antibodies or ligands that specifically target OR2T6-overexpressing cancer cells for delivery of cytotoxic agents

  • Gene therapy approaches: Silencing OR2T6 expression using RNA interference technologies to inhibit cancer progression

The development of such therapeutic strategies requires thorough screening and characterization of potential ligands, followed by assessment of their effects on cancer cell viability, proliferation, and metastatic potential.

What are the most promising techniques for studying OR2T6 structure-function relationships?

Advanced techniques for OR2T6 structure-function studies include:

  • Cryo-electron microscopy: For determining the three-dimensional structure of OR2T6, particularly in complex with ligands or signaling partners

  • Molecular modeling and docking simulations: To predict ligand binding sites and interactions, guiding rational drug design approaches

  • Mutagenesis studies: Systematic mutation of key residues to identify those critical for ligand binding, receptor activation, and downstream signaling

  • Resonance energy transfer techniques (FRET/BRET): To study conformational changes upon ligand binding and interactions with other proteins in real-time in living cells

  • Optogenetic approaches: Coupling light-sensitive domains to OR2T6 to achieve precise temporal control of receptor activation for studying signaling dynamics

These approaches, combined with functional assays, can provide comprehensive insights into how OR2T6 structure relates to its oncogenic functions.

What insights can multi-omics approaches provide in OR2T6 research?

Multi-omics integration can substantially advance OR2T6 research:

  • Transcriptomics: RNA-seq analysis of OR2T6-overexpressing or -silenced cells can reveal downstream gene expression changes, identifying affected pathways

  • Proteomics: Mass spectrometry-based approaches can identify:

    • Proteins that interact with OR2T6

    • Post-translational modifications affecting OR2T6 function

    • Global protein expression changes upon OR2T6 modulation

  • Metabolomics: Profiling metabolic changes in response to OR2T6 activation or inhibition can reveal metabolic dependencies of OR2T6-driven cancer processes

  • Single-cell analyses: Examining heterogeneity in OR2T6 expression and function within tumors can identify specific cell populations driving metastasis or therapy resistance

  • Spatial transcriptomics/proteomics: Mapping OR2T6 expression and its effects within the tumor microenvironment can provide insights into its role in tumor-stroma interactions

Integration of these multi-omics data through computational approaches can generate comprehensive models of OR2T6 function in cancer biology.

What are common challenges in OR2T6 expression systems and how can they be resolved?

Researchers frequently encounter several challenges when working with OR2T6 expression systems:

  • Poor surface expression: Olfactory receptors often have difficulty reaching the cell surface in heterologous expression systems

    • Solution: Co-express with chaperones like RTP1S, which strongly improves surface expression

    • Solution: Use specialized tags like Rho-tag, Lucy-tag, or IL-6-Halo-tag

    • Solution: Co-express with non-OR GPCRs that form heterodimers with ORs

  • Receptor internalization: Rapid internalization after activation limits response measurement

    • Solution: Co-express with M3 muscarinic acetylcholine receptor, which suppresses β-arrestin 2-mediated OR internalization

  • Weak signal transduction: ORs may couple poorly to endogenous G proteins in heterologous systems

    • Solution: Co-express olfactory-specific G protein α GNAL/Gαolf and the chaperone Ric-8B

    • Solution: Use highly sensitive detection systems like GloSensor™ for cAMP detection

  • Protein instability: OR2T6 may be unstable or form aggregates

    • Solution: Optimize culture conditions (temperature, pH)

    • Solution: Screen different detergents and buffer conditions for protein extraction

What emerging technologies might advance OR2T6 research in the next five years?

Several emerging technologies hold promise for advancing OR2T6 research:

  • Organoid models: Patient-derived breast cancer organoids expressing OR2T6 could provide more physiologically relevant systems for studying receptor function and testing targeted therapies

  • Microfluidic "organ-on-a-chip" systems: These could enable real-time measurement of OR2T6 activity in complex cellular environments that better mimic in vivo conditions

  • Advanced CRISPR technologies: Prime editing and base editing approaches could enable precise modification of OR2T6 to study specific amino acid contributions to function

  • Artificial intelligence for drug discovery: Machine learning approaches could accelerate identification of OR2T6 ligands by predicting binding affinities and biological activities

  • Nanobody-based tools: Development of OR2T6-specific nanobodies could enable super-resolution imaging of receptor trafficking and conformation-specific detection

  • Single-molecule imaging techniques: These could reveal the dynamics of OR2T6 interactions with ligands and signaling partners at unprecedented resolution

These technologies could dramatically accelerate understanding of OR2T6 biology and development of therapeutic approaches targeting this receptor.

What are the critical gaps in current OR2T6 research that need to be addressed?

Several critical knowledge gaps in OR2T6 research require attention:

  • Endogenous ligands: The natural ligands that activate OR2T6 remain unknown, limiting understanding of its physiological role

  • Signaling mechanisms: While OR2T6 appears to signal through MAPK pathways in cancer, the complete signaling network is poorly characterized

  • Tissue-specific functions: OR2T6 expression has been studied primarily in breast cancer, but its potential roles in other cancers and normal tissues require investigation

  • Regulation of expression: The mechanisms controlling OR2T6 expression in cancer versus normal tissues remain unclear

  • Clinical relevance: While OR2T6 correlates with poor outcomes, its potential as a therapeutic target or biomarker needs clinical validation

  • Structure-function relationships: The structural basis for OR2T6 activation and its interaction with downstream signaling proteins remains to be determined

Addressing these gaps through coordinated research efforts could substantially advance understanding of OR2T6 biology and its therapeutic potential in cancer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.