Recombinant Human Olfactory receptor 2T7 (OR2T7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Olfactory Receptor 2T7 (OR2T7)

Recombinant Human Olfactory Receptor 2T7 (OR2T7) is a synthetic, full-length transmembrane protein belonging to the G-protein-coupled receptor (GPCR) family, specifically Class O2 odorant receptors. Its biological role includes detecting odorant molecules, though recent studies suggest broader implications in cellular signaling and disease mechanisms .

Primary sequence highlights:

SegmentAmino Acid RangeKey Features
N-terminal1–40Signal peptide, TM1
TM2–TM750–300Hydrophobic core, ligand-binding pocket
C-terminal301–308Cytoplasmic tail, His-tag

2.2. Functional Insights

  • Ligand Binding: While no endogenous ligands are confirmed, analogs of other olfactory receptors (e.g., β-ionone, monoterpene) may activate OR2T7, triggering Gα-subunit binding and downstream signaling .

  • Pathway Involvement: Activation modulates p38 MAPK cascades, influencing proto-oncogenes (c-Fos, c-Jun, JunB) and tumor suppressors (RhoB, caspase-14) .

3.1. Recombinant Expression

OR2T7 is produced via bacterial expression in E. coli, with purification via nickel affinity chromatography due to its His-tag .

Mechanistic impact:

MutationEffectDownstream Consequences
D125VDisrupts cytofacial G-protein bindingReduced p38 MAPK activation → Downregulation of RhoB, caspase-14
Alters helical dynamics in TM3/TM6Impaired Gα-subunit coupling

Transcriptome changes:

GeneExpression ChangeFunctional Role
RhoBTumor suppression
Casp14Apoptosis regulation
c-Fos/c-JunCell cycle progression

Comparative Product Overview

SupplierCatalog IDTagPurityApplications
CusabioCSB-CF016621HUHisN/AStructural studies
Creative BioMartRFL565HFHis>90%SDS-PAGE, ELISA
AliCE®ABIN3112409StrepN/AWestern blotting

Future Directions

  • Therapeutic Potential: Targeting OR2T7 agonists for GBM treatment, leveraging insights from olfactory receptor-based anticancer strategies .

  • Structural Characterization: High-resolution crystallography to map ligand-binding motifs and G-protein interaction sites .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR2T7; OR2T7P; Olfactory receptor 2T7; OST723; olfactory receptor OR1-44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR2T7
Target Protein Sequence
MPTLSFWVCSATPVSPGFFALILLVFVTSIASNVVKIILIHIDSRLHTPMYFLLSQLSLR DILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSCDRYVAICNP LHYPDLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSC TDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRRKAVATCSSHMVVVS LFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGALQKVVGRCV SSGKVTTF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15019

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 2T7 and how is it classified?

Olfactory Receptor 2T7 (OR2T7) is a chemoreceptor belonging to the larger family of olfactory receptors (ORs). It is classified as a G protein-coupled receptor (GPCR) within the class A rhodopsin-like family. Like other olfactory receptors, OR2T7 is expressed in cell membranes of olfactory receptor neurons and is responsible for detecting odorant molecules and initiating signal transduction pathways that ultimately convey odor information to the brain . As part of the largest multigene family in vertebrates, OR2T7 is one of approximately 400 olfactory receptor genes found in humans, compared to about 1400 in mice .

Where is OR2T7 typically expressed in human tissues?

While olfactory receptors are primarily located in the cilia and synapses of olfactory sensory neurons within the nasal epithelium, research has revealed expression in other tissues as well . OR2T7, like some other olfactory receptors, has been detected in tissues outside the olfactory system. Notably, research has documented expression of OR2T7 in the U87MG glioblastoma cell line, suggesting potential functions beyond olfaction . This extra-nasal expression pattern has become increasingly relevant as researchers explore the non-canonical roles of olfactory receptors in health and disease.

How does the signal transduction mechanism of OR2T7 function?

OR2T7, like other olfactory receptors, operates through a G protein-coupled mechanism. When an appropriate ligand binds to OR2T7, the receptor undergoes conformational changes that allow it to bind and activate olfactory-type G proteins (Golf and/or Gs) on the intracellular side of the receptor neuron . This activation triggers a signaling cascade where:

  • The G protein activates adenylate cyclase

  • Adenylate cyclase converts ATP into cyclic AMP (cAMP)

  • cAMP opens cyclic nucleotide-gated ion channels

  • Calcium and sodium ions enter the cell

  • The neuron depolarizes, initiating an action potential

  • This signal carries information to the brain

This canonical pathway can vary in non-olfactory tissues, potentially explaining some of OR2T7's functions in other cellular contexts .

What experimental systems are commonly used to study OR2T7?

Several experimental approaches have been validated for studying OR2T7:

  • Cell culture systems: The U87MG glioblastoma cell line has been used to study OR2T7 expression and function, as confirmed by quantitative PCR (qPCR) techniques .

  • Computational modeling: Homology modeling using templates such as adenosine receptor A2a (PDB: 3PWH) has been employed to predict OR2T7 structure, despite only 28% sequence identity between OR2T7 and the template structure .

  • Molecular dynamics simulations: These have been used to explore the structural dynamics of both wild-type OR2T7 and mutant variants. Simulations typically run for microsecond timescales with multiple replicates to ensure adequate sampling of conformational states .

  • Transcriptome analysis: RNA sequencing has been used to identify differentially expressed genes in samples with OR2T7 mutations versus wild-type OR2T7 .

What is known about the D125V mutation in OR2T7 and its potential role in glioblastoma?

The D125V mutation in OR2T7 represents a somatic mutation identified in approximately 10% of 396 glioblastoma samples analyzed in The Cancer Genome Atlas. This mutation correlates with reduced progression-free survival for glioblastoma patients (log rank p-value = 0.05), suggesting a possible role in tumor progression . Notably, this mutation was not detected in any of the 2504 DNA sequences in the 1000 Genomes Project, indicating it may have a specific pathological relevance rather than being a common polymorphism .

Transcriptome analysis revealed that glioblastoma samples carrying the D125V mutation showed underexpression of several important signaling molecules and potential tumor suppressors, including:

  • p38α mitogen-activated protein kinase (MAPK)

  • c-Fos, c-Jun, and JunB proto-oncogenes

  • Putative tumor suppressors RhoB and caspase-14

These findings suggest that the D125V mutation may affect glioblastoma progression by potentially downregulating GPCR-p38 MAPK tumor-suppression pathways, highlighting OR2T7 as both a potential prognostic marker and therapeutic target for glioblastoma .

How does the D125V mutation affect the structural dynamics of OR2T7?

Molecular dynamics simulations provide significant insights into how the D125V mutation affects OR2T7 structure and function:

  • Conformational changes: The mutation impacts the "open" conformation of the GPCR, potentially affecting G-protein binding. Wild-type OR2T7 shows greater helical plasticity and samples multiple conformational states, while the D125V mutant demonstrates more rigidity and predominantly samples the "closed" conformation .

  • Transmembrane domain effects: Variation in the position and tilts of transmembrane domain 6 (TM6) helix is observed in wild-type OR2T7 structures but is altered in the D125V mutant. The angles and distances between TM6 and TM7 exhibit three sampling conformations for both systems: "open," intermediate, and "closed" .

  • Intracellular loop interactions: The switch between conformational ensembles appears to be facilitated by changes in interactions between intracellular loop 2 (ICL-2), which contains the 125 position, and intracellular loop 3 (ICL-3) .

These structural alterations could explain functional differences, as decreased ability to induce TM6 lateral movement toward an "open" conformation can slow G-protein activity, potentially influencing downstream signaling pathways relevant to tumor suppression .

What computational approaches are most effective for studying OR2T7 structure-function relationships?

Several computational methodologies have proven valuable for investigating OR2T7:

  • Homology modeling: Despite low sequence identity (28%) to template structures, MODELLER v. 9.22 has been successfully used to construct homology models of OR2T7, leveraging the highly conserved 7-transmembrane structural architecture of GPCRs .

  • Model validation: Rigorous validation of structural models using multiple complementary techniques is essential:

    • Ramachandran plots for backbone angles

    • ProSA for side-chain positioning

    • Swiss-Model Local Quality Estimate

    • Verify3D to analyze structural statistics against solved protein structures

  • Membrane environment simulation: CHARMM-GUI membrane builder has been used to prepare OR2T7 models in physiologically relevant membrane environments, with specific lipid compositions for exofacial and cytofacial membrane leaflets .

  • Molecular dynamics simulations: GROMACS software with the CHARMM36m force field has been employed to run microsecond-scale simulations with multiple replicates. Key parameters include:

    • Temperature: 310 K (physiological)

    • Pressure: 1 bar

    • Salt concentration: 0.15 M KCl

    • Water model: TIP3P

    • Simulation length: 1000 ns per system with 4 replicates

  • Convergence analysis: Root mean square deviation (RMSD) and RMSD clustering over sampling of the last 250 ns of simulation have been used to determine system convergence .

What is the proposed mechanism linking OR2T7 to downstream signaling in cancer contexts?

A hypothesized pathway connecting OR2T7 to cancer-relevant signaling has been proposed:

  • Activation of OR2T7 by an agonist (activating ligand) catalyzes the exchange of GDP for GTP on bound G-proteins.

  • GTP-bound Gα is released and triggers a p38 MAPK signaling cascade.

  • Activated p38α promotes the expression of:

    • c-Fos (via transcription factor TCF)

    • c-Jun and JunB (via activating transcription factor 2 and AP-1 subunits)

    • RhoB (via E1A-associated cellular P300 transcription factor and c-Jun)

    • Caspase-14 (via JunB and c-Jun)

  • This pathway promotes the expression of putative tumor suppressors RhoB and Caspase-14.

The D125V mutation appears to disrupt this pathway, potentially by affecting Gα-subunit binding due to altered structural dynamics, which may explain the observed downregulation of tumor suppressor pathways in glioblastoma samples carrying this mutation .

What are the best approaches for expression and purification of recombinant OR2T7?

While the search results don't provide specific protocols for OR2T7 expression and purification, general approaches for GPCR expression can be adapted:

  • Expression systems:

    • Mammalian cell lines (HEK293, CHO) provide proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) often yield higher protein amounts

    • Bacterial systems (E. coli) may require fusion partners and refolding strategies

  • Purification strategies:

    • Affinity tags (His, FLAG, or combination tags) for initial capture

    • Size exclusion chromatography for final purification and buffer exchange

    • Detergent selection is critical for maintaining GPCR structure

  • Stability considerations:

    • Addition of cholesterol or cholesteryl hemisuccinate to stabilize the receptor

    • Use of lipid nanodiscs or other membrane mimetics for functional studies

    • Temperature control during all purification steps

  • Quality control:

    • Circular dichroism to verify proper folding

    • Dynamic light scattering to assess homogeneity

    • Ligand binding assays to confirm functionality

How can researchers effectively study OR2T7-odorant interactions?

The emergence of databases like M2OR provides valuable resources for studying olfactory receptor-odorant interactions. For OR2T7 specifically:

  • Database resources:

    • M2OR database compiles experimental data from 42 scientific articles on OR-molecule interactions, including non-responsive experiments and detailed experimental conditions .

    • These resources can help identify potential ligands for deorphanization studies.

  • In vitro binding assays:

    • Heterologous expression systems coupled with calcium imaging

    • BRET/FRET-based assays to monitor conformational changes

    • cAMP accumulation assays to measure downstream signaling

  • Structure-based approaches:

    • Molecular docking using homology models

    • Virtual screening of odorant libraries

    • Molecular dynamics simulations to assess binding stability and conformational changes

  • Experimental validation:

    • Dose-response curves with identified ligands

    • Site-directed mutagenesis to identify key binding residues

    • Competition assays to determine binding specificity

What techniques are recommended for investigating the functional consequences of OR2T7 mutations?

Based on previous studies of the D125V mutation, several approaches can be employed:

  • Cellular assays:

    • G-protein activation assays (GTPγS binding, BRET-based sensors)

    • Signaling pathway analysis (phospho-specific antibodies, reporter gene assays)

    • Cell migration and proliferation assays for cancer-relevant phenotypes

  • Transcriptome analysis:

    • RNA sequencing to identify differentially expressed genes

    • Pathway enrichment analysis to identify affected signaling networks

    • Validation of key targets by qPCR and Western blot

  • Structural biology approaches:

    • Compare wild-type and mutant receptors using molecular dynamics simulations

    • Analyze critical parameters like TM6-TM7 distances and conformational sampling

    • Assess effects on G-protein binding interface

  • In vivo models:

    • CRISPR/Cas9-mediated introduction of mutations in cell lines or animal models

    • Patient-derived xenografts to study clinical relevance

    • Correlation of mutation status with clinical outcomes

How can researchers integrate computational and experimental approaches in OR2T7 research?

An integrated research strategy combines in silico and in vitro/in vivo approaches:

  • Iterative modeling and validation:

    • Generate structural predictions through homology modeling and molecular dynamics

    • Experimentally test key predictions through mutagenesis and functional assays

    • Refine models based on experimental results

  • Structure-based drug design:

    • Identify potential binding pockets in OR2T7 models

    • Screen for compounds that stabilize "active" or "inactive" conformations

    • Validate hits through binding and functional assays

  • Systems biology approaches:

    • Integrate transcriptome data with protein-protein interaction networks

    • Identify key nodes in OR2T7 signaling networks

    • Target these nodes for experimental validation

  • Translational research pipeline:

    • Identify mutation patterns in patient samples

    • Correlate with clinical outcomes and treatment responses

    • Develop personalized treatment strategies based on OR2T7 status

What are the major challenges in OR2T7 research?

Several significant challenges remain in studying OR2T7:

  • Low expression levels: Like many GPCRs, recombinant expression of sufficient quantities of functional OR2T7 remains technically challenging.

  • Ligand identification: The natural ligands for many olfactory receptors, including potentially OR2T7, remain unknown, complicating functional studies.

  • Structural determination: No high-resolution experimental structure exists for OR2T7, necessitating reliance on homology models despite low sequence identity to template structures.

  • Physiological relevance: Understanding the true biological significance of OR2T7 expression in non-olfactory tissues, particularly in cancer contexts, remains incomplete.

What emerging technologies might advance OR2T7 research?

Several cutting-edge approaches hold promise:

  • Cryo-EM for membrane protein structures: As resolution improves, direct structural determination of OR2T7 may become feasible.

  • Machine learning approaches: For improved homology modeling, ligand prediction, and integration of multi-omics data related to OR2T7 function.

  • Single-cell technologies: To better understand OR2T7 expression patterns in heterogeneous tissues and tumors.

  • Organoid models: For studying OR2T7 function in more physiologically relevant contexts than traditional cell lines.

  • PROTAC and molecular glue approaches: For targeted degradation or conformational stabilization of OR2T7 as potential therapeutic strategies.

Why is OR2T7 research clinically relevant?

The potential clinical significance of OR2T7 research centers on:

  • Prognostic biomarker potential: The D125V mutation correlates with reduced progression-free survival in glioblastoma patients, suggesting potential utility as a prognostic marker .

  • Therapeutic target development: OR2T7's role in tumor suppression pathways makes it a potential therapeutic target, particularly if agonists that promote anti-tumor signaling can be identified.

  • Precision medicine applications: Characterizing how specific mutations affect OR2T7 function could facilitate personalized treatment approaches for glioblastoma patients.

How does OR2T7 research contribute to our broader understanding of olfactory receptors?

OR2T7 research contributes to the expanding field of olfactory receptor biology in several ways:

  • Extra-nasal functions: Documentation of OR2T7 expression and function outside the olfactory epithelium supports the emerging understanding that olfactory receptors have diverse physiological roles beyond smell.

  • Signaling versatility: The connection between OR2T7 and the p38 MAPK pathway demonstrates how olfactory receptors can couple to different downstream pathways in different cellular contexts.

  • Structural insights: Computational studies of OR2T7 contribute to our understanding of the structural dynamics of olfactory receptors as a class, particularly regarding conformational changes associated with activation.

  • Disease relevance: The association between OR2T7 mutations and glioblastoma underscores the potential significance of olfactory receptors in disease processes, expanding their relevance beyond sensory perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.