Recombinant Human Olfactory receptor 3A3 (OR3A3)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptor 3A3

Olfactory Receptor 3A3 (OR3A3) belongs to the extensive family of olfactory receptors, which play a crucial role in the detection and discrimination of odorant molecules. OR3A3 is a member of the G-protein-coupled receptor (GPCR) superfamily, characterized by its seven-transmembrane domain structure . Like other olfactory receptors, OR3A3 functions by binding specific odorant molecules, initiating a neuronal response that triggers the perception of smell .

Olfactory receptors constitute the largest gene family in the human genome, with approximately 400 functional OR genes identified in humans. These receptors share structural similarities with many neurotransmitter and hormone receptors, highlighting their evolutionary significance and functional versatility . OR3A3 specifically belongs to family 3, subfamily A of this extensive receptor group, and has been the subject of increasing research interest due to its potential roles beyond the traditional olfactory system.

Gene and Nomenclature

OR3A3 is encoded by a single coding-exon gene, which is a common characteristic of olfactory receptor genes . The nomenclature of OR3A3 follows the systematic classification of olfactory receptors, with numerous synonyms documented in scientific literature, including:

SynonymsReferences
OR3A6, OR3A7, OR3A8P
OR17-16, OR17-137, OR17-201
Olfactory receptor 17-201
Olfactory receptor OR17-22

This diverse nomenclature reflects the evolving understanding of the olfactory receptor family and the independent naming systems applied to these receptors across different research groups and time periods .

Expression Systems

Recombinant human OR3A3 can be produced using various expression systems, each offering distinct advantages for different research applications. The major expression systems used for OR3A3 production include:

Expression SystemHostTagProduct CharacteristicsApplicationsReferences
Wheat germWheat germNone/GSTFull-length (1-321 aa), ProteoliposomeAffinity Purification
BacterialE. coliHisFull-length (1-321 aa)Western Blot, SDS
MammalianHEK-293 CellsHisFull-length (1-321 aa), >90% purityWestern Blot, SDS
Cell-freeCFPSStrepFull-length (1-321 aa), 70-80% purityWestern Blot, ELISA, SDS

The wheat germ expression system employs proprietary liposome technology to produce the recombinant protein, resulting in a preparation suitable for various biochemical and biophysical analyses . This system is particularly valuable for producing membrane proteins like OR3A3, which can be challenging to express in more conventional systems.

Purification and Handling

The purification of recombinant OR3A3 typically involves techniques appropriate for the specific tags incorporated during expression. For His-tagged variants, immobilized metal affinity chromatography is commonly employed, while GST-tagged versions can be purified using glutathione affinity columns .

Important handling considerations for recombinant OR3A3 include:

  1. Storage at -80°C to maintain protein integrity

  2. Avoidance of heating before electrophoresis to prevent protein aggregation

  3. Use within three months from receipt for optimal results

  4. Buffer composition: typically 25 mM Tris-HCl (pH 8.0) containing 2% glycerol

These handling precautions are critical for preserving the structural integrity and functional properties of the recombinant protein, especially given the inherent instability of many membrane proteins when removed from their native lipid environment.

Ectopic Expression Patterns

While olfactory receptors were initially believed to be exclusively expressed in olfactory sensory neurons, accumulating evidence demonstrates their expression in various non-olfactory tissues throughout the human body . Olfactory receptors have been detected in tissues including the testis, lung, intestine, skin, heart, and blood, suggesting functions beyond their traditional role in olfaction .

The specific expression pattern of OR3A3 across different tissues remains an area of active investigation. Like other ectopically expressed ORs, OR3A3 may exhibit tissue-specific functions that contribute to diverse physiological processes beyond smell perception.

Functional Implications

Ectopically expressed olfactory receptors have been implicated in various cellular processes, including:

  1. Modulation of cell-cell recognition

  2. Regulation of cell migration and proliferation

  3. Influence on apoptotic cycles

  4. Control of exocytosis

  5. Involvement in pathfinding processes

Interestingly, while olfactory receptors in nasal tissues primarily signal through canonical G-protein pathways, those expressed in non-olfactory tissues may utilize alternative signaling mechanisms . This signaling diversity expands the functional repertoire of these receptors and their potential physiological significance.

Potential Medical Relevance

The expression of olfactory receptors in various tissues has potential implications for medical research and clinical applications. There is growing evidence that certain ORs are highly expressed in different cancer tissues, suggesting their potential as diagnostic or therapeutic targets . Whether OR3A3 specifically has such applications remains to be determined through further research.

Ligand Identification and Characterization

Identifying the specific odorant molecules that activate OR3A3 remains an important research goal. Techniques such as calcium imaging, which measures transient elevations in intracellular calcium levels in response to receptor activation, have been successfully employed to identify ligands for other human olfactory receptors . Similar approaches could be used to deorphanize OR3A3 and characterize its ligand binding properties.

Improving Expression Systems

Despite advances in recombinant protein technology, the expression and purification of functional olfactory receptors remain challenging. Future research may focus on developing improved expression systems specifically optimized for OR3A3, potentially incorporating stabilizing mutations or fusion partners to enhance protein yield and stability.

Structure-Function Relationships

Detailed structural studies of OR3A3, potentially using techniques like X-ray crystallography or cryo-electron microscopy, could provide valuable insights into the molecular mechanisms of odorant recognition and receptor activation. Comparative analyses with other members of the OR3A subfamily might reveal evolutionary relationships and functional specializations.

Therapeutic and Diagnostic Applications

The potential involvement of olfactory receptors in various physiological and pathophysiological processes suggests promising applications in medicine. Further investigation of OR3A3's expression patterns in health and disease could reveal opportunities for its use as a diagnostic marker or therapeutic target.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
OR3A3; OR3A6; OR3A7; OR3A8P; Olfactory receptor 3A3; Olfactory receptor 17-201; OR17-201; Olfactory receptor 3A6; Olfactory receptor 3A7; Olfactory receptor 3A8; Olfactory receptor OR17-22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR3A3
Target Protein Sequence
MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS LRNTDVQGALCQLLVGKRSLT
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8284

KEGG: hsa:8392

STRING: 9606.ENSP00000291231

UniGene: Hs.532689

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR3A3 and how is it classified within the olfactory receptor family?

OR3A3 is a member of the olfactory receptor (OR) gene superfamily, which belongs to the class A G-protein-coupled receptors (GPCRs). Olfactory receptors constitute the largest transmembrane protein family in the human genome, with approximately 330 functional OR genes identified in humans . OR3A3 is classified within a standardized nomenclature system that organizes ORs based on sequence homology and phylogenetic relationships. The OR naming convention typically follows the pattern of "OR" followed by a family number, subfamily letter, and individual member number, reflecting evolutionary relationships between receptors .

For proper classification of any OR:

  • Compare the receptor's amino acid sequence with the established OR database

  • Analyze the transmembrane domains (particularly TM2-TM7 regions)

  • Determine sequence homology with other known ORs

  • Assign appropriate nomenclature based on sequence similarity (>60% identity typically indicates same subfamily)

What is the genomic structure and expression pattern of OR3A3?

OR3A3, like most olfactory receptors, has a characteristic genomic structure that includes:

  • An intronless coding region (typical of most OR genes)

  • A coding sequence spanning approximately 900-1000 base pairs

  • Seven transmembrane domains characteristic of GPCRs

While traditionally thought to be expressed exclusively in olfactory epithelium, recent research has demonstrated that ORs, including members of the OR3A family, can be expressed in multiple human tissues. Notably, comprehensive RNA-Seq analysis has detected OR transcripts in human spermatozoa, with 91 different OR transcripts identified across samples . Expression patterns can vary significantly between tissues and developmental stages, with some ORs showing both sense and antisense transcripts, suggesting complex regulatory mechanisms .

How should I design experiments to express recombinant OR3A3 in heterologous systems?

Designing effective expression systems for recombinant OR3A3 requires careful consideration of several factors:

Expression SystemAdvantagesDisadvantagesBest Applications
HEK293S cellsHigh transfection efficiency; Tetracycline-inducible systems availableMay require receptor trafficking enhancersFunctional characterization; Ligand screening
Sf9 insect cellsHigh protein yields; Better folding of GPCRsMore complex maintenance; Higher costStructural studies; Purification
E. coliSimple; Low cost; High yieldPoor folding; Lacks post-translational modificationsAntigen production; Truncated domains

Based on successful approaches with other ORs, a recommended protocol involves:

  • Engineer the OR3A3 coding sequence with epitope tags to facilitate detection and purification (e.g., N-terminal FLAG tag and C-terminal rho1D4 tag)

  • Clone the modified sequence into an appropriate expression vector (e.g., pCI plasmid)

  • Establish a stable tetracycline-inducible cell line (preferably HEK293S) for controlled expression

  • Verify expression through western blotting and immunocytochemistry

  • Optimize expression conditions through systematic variation of induction time, temperature, and media supplements

This approach has been successfully employed for functionally similar ORs and provides a solid foundation for OR3A3 expression .

What biosafety considerations should I address when working with recombinant OR3A3?

When conducting research with recombinant OR3A3, adherence to institutional and national biosafety guidelines is essential:

  • Recombinant OR3A3 experiments typically fall under NIH Guidelines Section III-E or III-F, requiring BSL-1 containment

  • If using viral vectors (e.g., lentiviral or adenoviral) for gene delivery, biosafety requirements increase to BSL-2 or BSL-2 enhanced depending on the specific vector system

  • Cell culture experiments utilizing standard cloning vectors with OR3A3 generally require BSL-1 conditions

Key considerations for experimental design include:

  • Register all recombinant/synthetic nucleic acid research with your institutional biosafety committee prior to initiation

  • Implement appropriate containment measures based on the vector system used

  • Follow institutional waste management protocols for all recombinant materials

  • Consider enhanced work practices when using viral vectors to prevent insertional mutagenesis risks

What are the most effective methods for purifying recombinant OR3A3?

Purification of recombinant OR3A3, like other membrane-bound olfactory receptors, presents significant challenges due to their hydrophobic nature and tendency to misfold. Based on successful approaches with other ORs, the following two-step purification strategy is recommended:

  • Solubilization and Initial Purification:

    • Harvest cells and disrupt membranes using mild detergents (DDM or DMNG typically yield best results)

    • Perform affinity chromatography using anti-FLAG immunoaffinity purification for the N-terminal FLAG tag

    • Elute using competitive FLAG peptide under gentle conditions to preserve protein structure

  • Secondary Purification:

    • Apply size exclusion chromatography to separate monomeric and oligomeric forms

    • Analyze fractions using size exclusion chromatography-multi-angle light scattering (SEC-MALS) to confirm protein state

Typical yields from sixty T175 flasks are approximately 1.6 mg for monomeric forms and 1.1 mg for dimeric forms, based on similar ORs . This purification approach effectively isolates properly folded receptor protein while minimizing aggregation and denaturation.

How can I verify the proper folding and functionality of purified OR3A3?

Verification of proper folding and functionality for purified OR3A3 requires multiple complementary approaches:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal stability assays to determine protein melting temperature

    • Limited proteolysis to probe structural integrity

  • Ligand Binding Assessment:

    • Intrinsic tryptophan fluorescence assays to quantify ligand binding

    • Surface plasmon resonance for kinetic binding parameters

    • Microscale thermophoresis for affinity determination in solution

  • Functional Verification:

    • Reconstitution into proteoliposomes for GTPγS binding assays

    • Single-channel recordings if reconstituted into planar lipid bilayers

    • Real-time cAMP assays in heterologous expression systems

For proper experimental controls, parallel analysis of a well-characterized OR (such as OR1A1) can serve as a useful benchmark for expected structural and functional parameters .

What methods are most effective for identifying ligands that activate OR3A3?

Identifying ligands for OR3A3 requires systematic screening approaches that can detect receptor activation. Based on successful deorphanization strategies for other ORs, the following methods are recommended:

  • Calcium Imaging Assays:

    • Express OR3A3 in Hana3A cells (engineered HEK293 cells with enhanced OR trafficking)

    • Load cells with calcium-sensitive fluorescent dyes (Fura-2/AM)

    • Screen odorant libraries in a systematic manner, starting with structurally diverse compounds

    • Monitor changes in intracellular calcium levels in response to potential ligands

  • cAMP Response Assays:

    • Utilize real-time cAMP detection systems (GloSensor or BRET-based approaches)

    • Test compounds individually and in mixtures to identify activating odorants

    • Develop dose-response curves to determine EC50 values for identified ligands

  • Receptor Internalization Assays:

    • Monitor receptor trafficking using fluorescently tagged OR3A3

    • Quantify internalization rates following exposure to potential ligands

For effective ligand screening, it's advisable to start with odorant mixtures representing different chemical classes, then perform secondary screens with individual components from activating mixtures. This approach has successfully identified specific odorants for other ORs (e.g., nerol for OR2W3, methional for OR2H1, and dimetol for OR10J1) .

How can I determine the binding affinity and specificity of ligands for OR3A3?

Determining binding affinity and specificity for OR3A3 ligands requires quantitative approaches that can distinguish between specific and non-specific interactions:

  • Intrinsic Tryptophan Fluorescence:

    • Exploit the natural fluorescence of tryptophan residues within the OR3A3 protein

    • Measure changes in fluorescence intensity or emission maximum upon ligand binding

    • Calculate dissociation constants (Kd) from titration experiments

  • Competitive Binding Assays:

    • Use a known ligand labeled with fluorescent or radioactive tags

    • Determine IC50 values for test compounds by measuring displacement of the labeled ligand

    • Convert IC50 values to Ki using the Cheng-Prusoff equation

  • Receptor Activation Dose-Response:

    • Measure functional responses (calcium flux or cAMP) across a range of ligand concentrations

    • Calculate EC50 values to determine potency

    • Compare EC50 values across structural analogs to develop structure-activity relationships

For properly folded ORs, binding affinities for cognate odorants typically fall in the micromolar range, as demonstrated with OR1A1 binding to dihydrojasmone . Experiment design should include appropriate positive controls (known OR-ligand pairs) and negative controls (structurally similar non-binding compounds).

How can OR3A3 be used to study sperm chemotaxis and its potential role in reproduction?

Investigating OR3A3's potential role in sperm chemotaxis requires specialized experimental approaches that build upon foundational knowledge of OR expression in reproductive tissues:

  • Expression Analysis in Reproductive Tissues:

    • Perform quantitative RT-PCR to confirm OR3A3 expression in human spermatozoa

    • Use immunocytochemistry with validated antibodies to determine subcellular localization

    • Compare expression levels across different sperm populations and fertility status

  • Functional Characterization in Spermatozoa:

    • Develop calcium imaging protocols for live sperm cells

    • Test identified OR3A3 ligands in sperm chemotaxis assays

    • Measure sperm motility parameters using computer-assisted sperm analysis (CASA)

  • Mechanistic Investigation:

    • Probe downstream signaling pathways using specific inhibitors

    • Develop OR3A3 knockout or knockdown models to assess functional significance

    • Compare with other characterized ORs in spermatozoa (e.g., OR2H1/2 and OR10J1)

Research has demonstrated that some ORs localize to specific compartments in human spermatozoa, suggesting distinct functions in reproductive processes . For example, immunocytochemical staining has shown OR2H1/2 localization in both the flagellum and head of spermatozoa, while OR10J1 localizes primarily to the flagellum and midpiece . Similar approaches could reveal the specific distribution and function of OR3A3.

What strategies can address the challenges in crystallizing OR3A3 for structural studies?

Crystallization of olfactory receptors represents one of the most challenging areas in structural biology due to their hydrophobic nature and conformational flexibility. For OR3A3, the following strategies can enhance crystallization success:

  • Protein Engineering Approaches:

    • Insert T4 lysozyme or BRIL in the third intracellular loop to increase polar surface area

    • Create truncated constructs removing flexible N and C-terminal regions

    • Develop thermostabilized variants through systematic mutagenesis of residues

    • Consider fusion partners that facilitate crystal contacts

  • Lipidic Mesophase Crystallization:

    • Utilize lipidic cubic phase (LCP) or sponge phase crystallization

    • Screen various lipid compositions to identify optimal matrix

    • Incorporate specific ligands to stabilize receptor conformation

  • Alternative Structural Approaches:

    • Consider single-particle cryo-electron microscopy for structure determination

    • Employ hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Utilize NMR spectroscopy for specific domains or ligand interactions

Successful purification approaches yielding milligram quantities of properly folded receptor protein, as demonstrated with OR1A1 , provide the necessary foundation for crystallization trials. The purified monomeric form (1.6 mg from sixty T175 flasks) represents the most promising starting material for structural studies .

How can I address poor expression and misfolding issues when working with recombinant OR3A3?

Poor expression and protein misfolding are common challenges when working with olfactory receptors. For OR3A3, implement these evidence-based solutions:

  • Expression Enhancement Strategies:

    • Co-express with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs)

    • Optimize codon usage for the expression system

    • Include N-terminal trafficking sequences (e.g., rhodopsin N-terminal sequence)

    • Utilize inducible expression systems with optimized induction parameters

  • Folding Improvement Approaches:

    • Reduce expression temperature (28-30°C) during induction phase

    • Add chemical chaperones to culture media (e.g., DMSO, glycerol, or specific ligands)

    • Include cholesterol or other lipids in the expression media

    • Test different detergents for solubilization (DDM, DMNG, LMNG)

  • Protein Stabilization Methods:

    • Include identified ligands during purification to stabilize native conformation

    • Optimize buffer conditions through systematic screening (pH, salt, additives)

    • Consider nanodiscs or amphipols for maintaining native-like lipid environment

Experimental evidence from similar ORs indicates that tagging strategies significantly impact expression and trafficking efficiency. The combination of N-terminal rhodopsin tag (first 20 amino acids of rhodopsin) with C-terminal epitope tags has proven effective for OR expression in heterologous systems .

What approaches can help resolve contradictory data when characterizing OR3A3 ligand interactions?

When facing contradictory data regarding OR3A3 ligand interactions, implement these systematic troubleshooting approaches:

  • Technical Validation:

    • Verify receptor expression and proper trafficking using immunocytochemistry

    • Confirm protein integrity through western blotting and glycosylation analysis

    • Validate assay performance using positive controls (known OR-ligand pairs)

    • Ensure ligand purity and stability throughout experimental procedures

  • Methodological Cross-Validation:

    • Compare results across multiple functional assays (calcium imaging, cAMP, GTPγS binding)

    • Perform direct binding studies using purified receptor and potential ligands

    • Conduct competition assays to assess specificity of interactions

    • Develop structure-activity relationships to rationalize binding patterns

  • Contextual Factors Analysis:

    • Evaluate influence of different expression systems on receptor functionality

    • Assess impact of membrane composition on ligand access and binding

    • Consider potential influences of receptor oligomerization on signaling properties

    • Examine downstream signaling pathway variations across experimental systems

Data interpretation should consider that ORs exhibit varying degrees of ligand promiscuity, with some responding to a broad spectrum of odorants while others demonstrate high specificity for structurally related compounds . Additionally, antisense transcripts detected for some ORs might indicate complex regulatory mechanisms affecting receptor expression and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.