Recombinant Human Olfactory receptor 4A47 (OR4A47)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Recombinant Human Olfactory Receptor 4A47 (OR4A47) is a lab-engineered version of the olfactory receptor protein encoded by the OR4A47 gene in humans . As a member of the G-protein-coupled receptor (GPCR) superfamily, OR4A47 facilitates odorant detection by initiating neuronal signaling upon binding to specific odor molecules . Key features include:

  • Structure: A seven-transmembrane domain architecture typical of GPCRs, critical for odorant recognition and signal transduction .

  • Gene Location: Chromosome 11p11.2 .

  • Function: Implicated in chemosensory perception and G-protein-mediated signaling pathways .

Role in Sperm Function

OR4A47 is detected in human spermatozoa, where olfactory receptors are hypothesized to guide chemotaxis toward the oocyte . Key findings:

  • Localization: Immunocytochemistry shows OR4A47 and related receptors (e.g., OR2H1, OR10J1) in sperm flagella and midpiece regions .

  • Ligand Screening: Calcium imaging assays in Hana3A cells identified agonists like nerol and methional for related receptors, though OR4A47-specific ligands remain uncharacterized .

Ligand Interaction Studies

The M2OR database (2023) catalogs >51,000 OR-odorant pairs, though OR4A47 ligands are yet to be deorphanized . Functional assays rely on:

  • Calcium Imaging: Measures intracellular Ca²⁺ flux in transfected HEK293 cells .

  • Luciferase Reporter Systems: Utilizes Hana3A cells co-expressing RTP1/2 chaperones for high-throughput screening .

Challenges and Future Directions

  • Ligand Specificity: OR4A47 remains an "orphan" receptor with no confirmed agonists .

  • Structural Studies: Cryo-EM or X-ray crystallography is needed to resolve its 3D conformation .

  • In Vivo Relevance: Functional roles in non-olfactory tissues (e.g., sperm, prostate) require validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have specific tag type preferences, please inform us, and we will prioritize development of the specified tag.
Synonyms
OR4A47; Olfactory receptor 4A47; Olfactory receptor OR11-113
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4A47
Target Protein Sequence
MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF LAGLSFIDIIYSSSISPRLISGLFFGNNSISFQSCMAQLFIEHIFGGSEVFLLLVMAYDC YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVFQLSIIYGLPFCGPNVIDHFFCDMY PLLKLVCTDTHAIGLLVVANGGLACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSS HMTVVVFFFVPCIFMYARPARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLW RRDLISSST
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 31266

KEGG: hsa:403253

STRING: 9606.ENSP00000412752

UniGene: Hs.554532

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of OR4A47?

OR4A47 is classified as a G-protein-coupled receptor (GPCR) belonging to the Class A (rhodopsin-like) GPCR family. It features the characteristic 7-transmembrane domain structure shared by other GPCRs, with each domain spanning the plasma membrane . The protein is encoded by a single coding-exon gene, which is typical for olfactory receptors . Structurally, OR4A47 shares this 7-transmembrane architecture with many neurotransmitter and hormone receptors, positioning it within the GPCR family 1 . This structural classification is significant for understanding its function in olfactory signal transduction and for designing experiments to study its activity.

What are the key functional domains of OR4A47?

The functional domains of OR4A47 include seven transmembrane regions that anchor the protein within the cell membrane, extracellular domains that interact with odorant molecules, and intracellular domains that couple with G-proteins to initiate signal transduction . The protein contains several conserved motifs common to Class A GPCRs, potentially including CWxP, DRY, NPxxY and PIF motifs, which are critical for receptor activation and signaling . The ligand-binding pocket at the extracellular side recognizes specific odorants, while the intracellular regions mediate interactions with G-proteins to propagate the signal downstream . These domains work in concert to detect odorant molecules and translate this chemical interaction into a neuronal response that eventually leads to smell perception.

How does OR4A47 fit into the broader GPCR family?

OR4A47 belongs to the olfactory receptor subfamily within the larger GPCR superfamily. The olfactory receptor gene family is notably the largest in the human genome . Within this classification, OR4A47 is specifically categorized as a member of family 4, subfamily A . It shares the canonical 7-transmembrane structure with other GPCRs and participates in the common GPCR activation pathway identified across Class A GPCRs . An important paralog of OR4A47 is OR4A5, suggesting evolutionary relationships within the olfactory receptor family . According to UniProt classification, it belongs to the G-protein coupled receptor 1 family . This positioning within the GPCR family is significant for comparative studies and for understanding evolutionary relationships between different olfactory receptors and other GPCRs.

What cellular pathways involve OR4A47?

OR4A47 is primarily involved in the olfactory signaling pathway. The key cellular processes include odorant binding, where OR4A47 interacts with specific odorant molecules in the nasal cavity . Upon odorant binding, OR4A47 undergoes conformational changes that activate associated G-proteins, which then trigger downstream signaling cascades . This signaling ultimately leads to action potentials in olfactory neurons, which are integrated in the brain to create the perception of smell . The pathway involves multiple molecular events, including the hallmark outward movement of transmembrane helix 6 (TM6) during GPCR activation, which couples agonist binding to G-protein recruitment . Understanding these pathways is essential for researchers investigating olfactory signal transduction mechanisms and sensory perception.

How do conformational changes in OR4A47 affect its function?

Conformational changes in OR4A47, like other Class A GPCRs, are critical for its function in signal transduction. The activation of OR4A47 likely involves the hallmark outward movement of transmembrane helix 6 (TM6), which is characteristic of GPCR activation . This conformational change couples odorant binding to G-protein recruitment. The common activation pathway for Class A GPCRs involves 34 residue pairs (formed by 35 residues) with conserved rearrangement upon activation .

Key conformational changes include:

  • Switching contacts: Breaking of ionic locks between specific residues, such as those at positions 3×50 and 6×34 (using GPCRdb numbering)

  • Repacking contacts: Changes in residue packing, such as decreased packing between W 6×48 and F 6×44

  • Translocation of certain residues, like N 7×49 moving toward D 2×50 upon activation

These conformational changes directly link the bottom of the ligand-binding pocket with the G-protein coupling region, creating a continuous activation pathway . For OR4A47 research, understanding these conformational dynamics is essential for studies on odorant recognition, receptor activation, and signal transduction efficiency.

What are the challenges in expressing recombinant OR4A47?

Expressing recombinant OR4A47 presents several challenges common to GPCR research. As a 7-transmembrane protein, OR4A47 requires a lipid bilayer environment for proper folding and function . GPCRs typically have low expression yields in heterologous systems, and the transmembrane nature of OR4A47 makes it inherently unstable when removed from its native membrane environment . Ensuring correct folding of the recombinant protein is challenging, particularly for the transmembrane domains, and any required post-translational modifications must be properly executed by the expression system .

Recent advances in GPCR research suggest potential solutions, including the use of fusion proteins to enhance stability and expression, as demonstrated by the "click fusion" approach for other GPCRs . This method involves the rational design of structurally stable protein domains rigidly linked to GPCRs, enhancing thermostability and aiding in structural studies via techniques like cryo-electron microscopy . Other strategies include expression in specialized cell lines optimized for membrane protein production, addition of stabilizing modifications or partners, and use of detergents or nanodiscs to maintain native-like environments.

How do mutations in OR4A47 affect olfactory signaling?

Mutations in OR4A47 would likely affect olfactory signaling in several ways, based on insights from the common GPCR activation pathway research. Alterations in the extracellular domains or ligand-binding pocket residues would affect odorant recognition specificity and affinity . The common activation pathway for Class A GPCRs involves 34 residue pairs, and mutations in these residues could disrupt the transmission of conformational changes from the ligand-binding site to the G-protein coupling region .

Changes in the intracellular domains involved in G-protein interaction could alter signaling efficiency or specificity . Importantly, rational mutations of residues in the activation pathway can generate receptors that are constitutively active or inactive, as demonstrated for other GPCRs . The common activation pathway provides a mechanistic interpretation of constitutively activating, inactivating, and disease mutations in GPCRs . For OR4A47 research, site-directed mutagenesis experiments targeting key residues would help elucidate their specific roles in olfactory signaling and could potentially lead to the development of receptors with modified properties for research applications.

What are the implications of OR4A47 in neurological research?

OR4A47, as an olfactory receptor, has several important implications for neurological research. It initiates neuronal responses that trigger smell perception, making it a model for studying sensory neuron signaling mechanisms . As a member of the largest GPCR family, OR4A47 serves as a valuable model for understanding general GPCR activation and signaling principles, which is significant given that approximately one-third of all marketed drugs target GPCRs .

Olfactory receptors like OR4A47 play roles in the development and organization of neural circuits in the olfactory system. Additionally, olfactory dysfunction is an early symptom in several neurodegenerative diseases, making olfactory receptors relevant targets for such studies. The olfactory system exhibits significant plasticity, with OR4A47 potentially involved in adaptive responses to environmental changes. Understanding OR4A47 structure and function contributes to the broader knowledge of GPCR biology, which is crucial for drug discovery and development of therapeutics for various neurological conditions .

What methods are most effective for detecting recombinant OR4A47 in samples?

Several methods are effective for detecting recombinant OR4A47 in experimental samples, each with specific advantages for different research questions:

Detection MethodPrincipleAdvantagesLimitationsBest Applications
ELISAOR4A47 antibody-antigen interactions with HRP colorimetric detection Quantitative, high throughput, commercially available kits May not detect all forms of recombinant proteinQuantification in tissue homogenates and body fluids
Western BlotSeparation by molecular weight followed by immunodetectionConfirms size and integrity, detects modified formsSemi-quantitative, lower throughputVerification of expression, molecular weight confirmation
ImmunofluorescenceAntibody-based detection in fixed cells/tissuesVisualizes subcellular localizationLimited quantificationMembrane localization studies
Functional AssaysMeasures receptor activity (e.g., calcium flux, G-protein activation)Confirms functional activity, not just presenceRequires specialized equipmentVerification of functional recombinant protein
Mass SpectrometryPeptide mass fingerprintingHigh specificity, can identify modificationsComplex sample preparation, expensiveDetailed protein characterization

ELISA kits designed specifically for OR4A47 detection can quantify native OR4A47 in undiluted body fluids and tissue homogenates . For recombinant protein detection, assays may need optimization or tag-specific antibodies. The choice of method depends on the specific research question, with ELISA being advantageous for quantification, western blot for size verification, and functional assays for confirming activity.

How can researchers optimize expression systems for OR4A47?

Optimizing expression systems for recombinant OR4A47 requires addressing the challenges inherent to GPCR expression. Mammalian cell lines (HEK293, CHO) provide proper folding and post-translational modifications, while insect cells (Sf9, Sf21) often yield higher expression levels for GPCRs. Bacterial systems are generally less suitable due to limited membrane protein processing capabilities.

The "click fusion" approach described for other GPCRs can be adapted for OR4A47 . This involves rational design of structurally stable protein domains rigidly linked to the GPCR, which enhances thermostability and aids in determining GPCR structures via cryo-electron microscopy . T4 lysozyme or BRIL insertions in the third intracellular loop can enhance stability, while N-terminal fusions (such as MBP or SUMO) can improve folding and solubility.

Additional optimization strategies include codon optimization to adapt the OR4A47 coding sequence to the preferred codon usage of the expression host, using inducible expression systems to control expression timing and level, and optimizing culture conditions such as temperature reduction during expression and addition of chemical chaperones. Implementing reporter tags (GFP, FLAG, His) for easy monitoring of expression and establishing functional assays to confirm proper folding and activity are also important considerations.

What are the best approaches for studying OR4A47 activation mechanisms?

To study OR4A47 activation mechanisms, researchers can employ several complementary approaches. Structural analysis techniques such as cryo-electron microscopy (cryo-EM) have proven valuable for GPCR structural studies and can be facilitated by fusion protein approaches . X-ray crystallography, though challenging for GPCRs, provides high-resolution structural information, while NMR spectroscopy is useful for dynamic studies of smaller receptor fragments.

For conformational change analysis, the RRCS (Residue-Residue Contact Score) methodology quantifies conformational changes between active and inactive states . This approach captures both major rearrangements and subtle but conserved changes at the residue level . ∆RRCS calculations can identify conserved rearrangement of residue contacts upon activation .

Molecular dynamics simulations can model conformational changes and activation pathways, particularly the outward movement of TM6 and other activation hallmarks . Site-directed mutagenesis targeting residues in the common activation pathway can test for constitutive activity or inactivity of mutants . Functional assays such as GTPγS binding, calcium mobilization, and beta-arrestin recruitment provide direct measures of receptor activation. These approaches, particularly when used in combination, can provide comprehensive insights into OR4A47 activation mechanisms.

What structural analysis techniques are suitable for OR4A47 research?

Several structural analysis techniques are particularly suitable for OR4A47 research, each with specific advantages. Cryo-electron microscopy (cryo-EM) is increasingly the method of choice for GPCR structural studies as it doesn't require crystallization, overcoming a major hurdle in GPCR structural biology . The technique can be enhanced using fusion protein approaches to improve stability and allows visualization of the receptor in various conformational states .

X-ray crystallography provides high-resolution structural data but is challenging for GPCRs and may require lipidic cubic phase crystallization methods and extensive protein engineering, such as the "click fusion" approach . Nuclear Magnetic Resonance (NMR) spectroscopy is useful for studying dynamics and ligand interactions, particularly for receptor fragments or specific domains rather than the full protein.

Molecular modeling and simulation methods include homology modeling based on known GPCR structures, molecular dynamics simulations to study conformational changes and activation mechanisms, and docking studies to predict ligand binding modes . Additional techniques include hydrogen-deuterium exchange mass spectrometry (HDX-MS) to provide information on protein dynamics and solvent accessibility, site-directed fluorescence spectroscopy to monitor conformational changes, and cross-linking mass spectrometry to identify residues in close proximity in the native structure.

How should researchers interpret ELISA results for OR4A47?

Interpreting ELISA results for OR4A47 requires careful consideration of several factors. ELISA kits for OR4A47 include concentration gradients of standards that render a theoretical detection range . Researchers should plot absorbance values against known concentrations to create a standard curve, which is then used to determine OR4A47 concentrations in unknown samples. It's important to ensure the standard curve is linear within the working range, typically using a log-log plot.

Quality control metrics should be assessed using intra-assay CV (%) and inter-assay CV(%), which evaluate variation within a single experiment and between different experiments, respectively . CV values less than 10% generally indicate good precision. Commercial ELISA kits for OR4A47 are designed to detect native, not recombinant, OR4A47, so for recombinant protein detection, researchers should consider whether structural differences might affect antibody recognition .

Appropriate sample types include undiluted body fluids and/or tissue homogenates . Researchers should consider how sample preparation methods might affect protein structure and detection and evaluate potential matrix effects from complex biological samples. For comparative studies, consistent experimental conditions across all samples are essential. Including positive controls to confirm assay functionality and negative controls to establish background signal levels is critical for proper interpretation.

What are common pitfalls in analyzing OR4A47 expression data?

Several common pitfalls can affect the analysis of OR4A47 expression data. When analyzing OR4A47 mRNA expression, selecting unstable reference genes can lead to incorrect normalization. Researchers should use multiple validated reference genes appropriate for the tissue/cell type and experimental conditions.

Antibodies against OR4A47 may cross-react with other olfactory receptors, particularly close paralogs like OR4A5, leading to overestimation of specific OR4A47 expression . Antibody specificity should be validated through knockout/knockdown controls or peptide competition assays. Differences in post-translational modifications between native and recombinant OR4A47 may affect detection, so researchers should consider how expression systems might alter glycosylation or other modifications.

As a membrane protein, OR4A47 should localize to the plasma membrane, but misfolded recombinant protein may accumulate in the endoplasmic reticulum . It's important to distinguish between total protein levels and functionally relevant membrane-localized protein. Statistical analysis errors can occur when using inappropriate tests for the data distribution or failing to account for multiple comparisons in complex experiments. High expression levels may not correlate with functional activity, so researchers should include functional assays alongside expression analysis.

How can researchers validate OR4A47 activation in experimental settings?

Validating OR4A47 activation requires multiple complementary approaches. G-protein coupling assays, such as GTPγS binding, measure G-protein activation following odorant exposure and directly assess the key functional outcome of receptor activation . Second messenger production assays measuring cAMP levels or calcium mobilization provide functional readouts of the signaling cascade initiated by OR4A47 activation.

Conformational change analysis can be performed using the RRCS (Residue-Residue Contact Score) methodology to quantify conformational changes . Researchers can monitor the hallmark outward movement of transmembrane helix 6 (TM6) characteristic of GPCR activation and use fluorescence-based approaches to detect conformational changes. Mutagenesis validation involves creating constitutively active or inactive mutants based on the common activation pathway residues to serve as positive and negative controls for activation .

Pharmacological validation uses known agonists and antagonists to confirm expected activation patterns, demonstrating dose-dependent responses to ligands and specificity of activation through competition experiments. Receptor internalization can be monitored following activation, and β-arrestin recruitment can be assessed using BRET or FRET-based approaches. A comprehensive validation approach would include multiple methods to establish confidence in the observed activation patterns of OR4A47 in experimental settings.

Why might recombinant OR4A47 show reduced functionality in vitro?

Recombinant OR4A47 may show reduced functionality in vitro for several reasons. The complex 7-transmembrane structure of OR4A47 makes correct folding challenging in heterologous expression systems, and misfolded protein may retain some structural epitopes but lack functional capability . GPCRs like OR4A47 are sensitive to their lipid environment, and heterologous expression systems may not provide the optimal membrane composition found in olfactory neurons .

Expression systems may not replicate all necessary post-translational modifications, and glycosylation or other modifications might be essential for full functionality. Olfactory receptor function may depend on accessory proteins not present in heterologous systems, such as receptor transporters, chaperones, or modulatory proteins. Expression systems may not provide the optimal G-protein subtypes for OR4A47, and the common activation pathway may be compromised by subtle differences in the cellular environment .

Constitutive activity or exposure to agonists during expression may lead to desensitization, reducing apparent functionality in subsequent assays. The inherent instability of GPCRs in detergent solutions or non-native environments is also a significant challenge . Fusion protein approaches, such as the "click fusion" strategy, might help address these issues by enhancing stability and proper folding .

How can researchers address instability issues with recombinant OR4A47?

Addressing instability issues with recombinant OR4A47 requires strategic approaches. The "click fusion" strategy described for other GPCRs involves rational design of structurally stable protein domains rigidly linked to the receptor . This approach enhances thermostability of the target GPCR and can be transferred among structurally similar GPCRs with minor adjustments to the linker region .

Thermostabilizing mutations can be introduced by focusing on residues in the common activation pathway that might stabilize either active or inactive conformations . Alanine scanning can help identify stabilizing mutations. Lipid environment optimization involves including specific lipids during purification and storage, using nanodiscs or lipid bilayer systems to maintain a native-like environment, and optimizing detergent types and concentrations for membrane protein stability.

Buffer composition refinement includes screening different buffer systems, pH values, and ionic strengths, including stabilizing additives like glycerol or specific ions, and considering including ligands or antagonists to stabilize specific conformations. Storage condition optimization requires determining optimal temperature, concentration, and additive requirements, assessing freeze-thaw stability, and developing appropriate aliquoting strategies. Construct design improvements might involve removing flexible regions that contribute to instability or adding/removing tags based on their impact on stability.

What are common contamination issues in OR4A47 preparations and how to resolve them?

Common contamination issues in OR4A47 preparations include endogenous GPCR contamination from expression systems. This can be addressed by using epitope tags for selective purification and verifying purity using mass spectrometry or western blotting with OR4A47-specific antibodies . Bacterial endotoxin contamination can affect downstream functional assays and cell-based experiments. Researchers should use endotoxin removal columns during purification and test final preparations with limulus amebocyte lysate (LAL) assays.

Protein aggregation is another common issue, as misfolded OR4A47 can form aggregates that co-purify with functional protein. Size exclusion chromatography as a final purification step and optimizing detergent or lipid compositions can help reduce aggregation. Proteolytic degradation generating contaminating fragments can be addressed by including protease inhibitors throughout the purification process and verifying protein integrity by SDS-PAGE and mass spectrometry.

Excess detergents or lipids can interfere with functional and structural studies. Careful control of detergent concentrations and appropriate detergent removal methods are essential. Different conformational states or misfolded variants may co-purify; using ligands or nanobodies to select specific conformational states and the "click fusion" approach can enhance the proportion of correctly folded receptors . Host cell protein contamination can be addressed by implementing multiple orthogonal purification steps and using targeted methods like immobilized metal affinity chromatography with polyhistidine tags.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.