Recombinant Human Olfactory receptor 4B1 (OR4B1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant OR4B1 is primarily used in biochemical research to study olfactory receptor function and ligand interactions.

Research applications:

  • Odorant binding studies: Though OR4B1’s specific ligands remain unidentified, recombinant forms enable screens for odorant-receptor interactions .

  • Antibody validation: Used as a positive control in immunostaining protocols .

Expression and Localization

While native OR4B1 is expressed in olfactory sensory neurons, recombinant forms lack tissue-specific localization data. Notably:

  • OR4B1 shares 55% sequence identity with mouse and rat orthologs .

  • No peer-reviewed studies confirm its expression in non-olfactory tissues, unlike other ORs detected in spermatozoa .

Research Challenges and Knowledge Gaps

OR4B1 remains undercharacterized compared to other olfactory receptors:

AspectStatus
Known ligandsNone identified; absent from M2OR database (51,395 OR-odorant pairs)
Functional assaysLimited to calcium imaging and luciferase reporter systems
Structural dataNo crystallography or cryo-EM studies available
Disease associationsNone reported in Pharos (disease knowledge score: 0.31)

Comparative Analysis of Olfactory Receptor Databases

OR4B1’s absence from major interaction databases highlights its understudied nature:

DatabaseOR4B1 InclusionTotal OR-Odorant Pairs
M2ORNo51,395
OlfactionBaseNo874
OdorDBNo402

Sources: M2OR (2023), OdorDB (2000), OlfactionBase (2022)

Future Directions

  • Deorphanization efforts: High-throughput screening using recombinant OR4B1 could identify agonists/antagonists.

  • Structural studies: Resolving its 3D conformation may elucidate binding mechanisms.

  • In vivo models: Knockout mice could clarify physiological roles beyond olfaction.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
OR4B1; Olfactory receptor 4B1; OST208; Olfactory receptor OR11-106
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4B1
Target Protein Sequence
MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFF LSCLSLVEISYSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDC YVAICKPLHYMNIISRQLCHLLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQ PLFKLACTDTFMEGVIVLANSGLFSVFSFLILVSSYIVILVNLRNHSAEGRHKALSTCAS HITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKIAIRRLW SKKENPGRE
Uniprot No.

Target Background

Function

Odorant receptor.

Database Links

HGNC: 8290

KEGG: hsa:119765

STRING: 9606.ENSP00000311605

UniGene: Hs.553566

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4B1 and how does it function in the olfactory system?

OR4B1 (Olfactory receptor 4B1), also known as Olfactory receptor OR11-106, is a 309 amino acid multi-pass membrane protein that functions as an odorant receptor in the human olfactory system . It belongs to the class A G-protein-coupled receptor (GPCR) superfamily, which constitutes the largest transmembrane protein family in the human genome . OR4B1 localizes to the cilia of olfactory sensory neurons where it binds odor molecules with specific structural characteristics .

The functional mechanism of OR4B1 follows the standard olfactory signal transduction pathway. When an appropriate odorant binds to OR4B1, it triggers a conformational change in the receptor that activates associated G proteins. This activation leads to the stimulation of olfactory-enriched adenylate cyclase, resulting in increased production of cyclic AMP (cAMP) . The elevated cAMP levels then open cyclic nucleotide-gated ion channels, causing membrane depolarization and generation of action potentials that transmit signals to the primary olfactory cortex for odor perception . This combinatorial coding system allows humans to detect and discriminate among thousands of diverse odorants despite having a limited number of functional OR genes .

How is OR4B1 structured and what are its key protein domains?

OR4B1, like other olfactory receptors, possesses the characteristic seven-transmembrane domain structure typical of G-protein-coupled receptors. The protein contains extracellular N-terminal and intracellular C-terminal domains, with three extracellular loops and three intracellular loops connecting the transmembrane helices . The transmembrane domains form a pocket that serves as the binding site for odorant molecules.

Comparative studies show that OR4B1 shares approximately 55% sequence identity with its mouse and rat orthologs . The protein contains specific regions critical for ligand binding and G-protein coupling. Though complete structural information about OR4B1 specifically is limited, research on other olfactory receptors has shown that the third, fifth, and sixth transmembrane domains often contain residues crucial for odorant recognition . Advanced structural biology techniques, including crystallography and NMR studies, are being applied to better understand the structure-function relationships of olfactory receptors like OR4B1 .

What expression systems are most effective for producing recombinant OR4B1?

For the heterologous expression of human olfactory receptors like OR4B1, inducible mammalian cell expression systems have proven most effective. Specifically, tetracycline-inducible HEK293S cell lines have been successfully used for the controlled expression of recombinant olfactory receptors . This system allows researchers to regulate expression levels, potentially reducing cytotoxicity that can occur with constitutive overexpression of membrane proteins.

To enhance detection and purification, the OR4B1 construct should be engineered with appropriate epitope tags. A dual-tagging approach has been effective, with a C-terminal rho1D4 epitope tag and an N-terminal FLAG epitope tag . The FLAG tag facilitates immunoaffinity purification, while the rho1D4 tag provides an additional purification option and detection capability. Together, these modifications enable a two-step purification process while maintaining the receptor's functional integrity.

Alternative expression systems, such as baculovirus-infected insect cells, have also been employed for olfactory receptor expression, though with variable success rates. Regardless of the expression system chosen, codon optimization of the OR4B1 sequence for the host organism and inclusion of trafficking enhancement sequences may significantly improve surface expression levels .

What are the optimal purification strategies for recombinant OR4B1?

Purification of recombinant OR4B1 requires a carefully optimized protocol to maintain protein stability and functional integrity. Based on successful approaches with other olfactory receptors, a two-step purification strategy is recommended . First, perform monoclonal anti-FLAG immunoaffinity purification to capture the tagged receptor from detergent-solubilized cell lysates. This should be followed by size exclusion chromatography (gel filtration) to separate monomeric and dimeric forms of the receptor and remove any remaining contaminants .

The choice of detergent is critical for maintaining OR4B1 in its native conformation during solubilization and purification. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) supplemented with cholesterol hemisuccinate (CHS) have proven effective for other olfactory receptors . The purification process should be conducted at 4°C to minimize protein degradation, and protease inhibitors should be included in all buffers.

Using this approach, researchers have successfully purified both monomeric and dimeric forms of olfactory receptors. For instance, from sixty T175 flasks of cultured cells, approximately 1.6 mg of monomeric and 1.1 mg of dimeric forms of a tagged olfactory receptor have been obtained . The purified receptor should be assessed for proper folding using circular dichroism analysis before proceeding to functional studies .

How can the functional activity of recombinant OR4B1 be assessed in vitro?

Functional characterization of recombinant OR4B1 can be accomplished through several complementary approaches. The most direct method is a real-time cAMP assay in heterologous cells expressing the receptor . Following stimulation with potential ligands, changes in intracellular cAMP levels can be measured using FRET-based sensors or other cAMP detection methods. This assay provides information about the receptor's ability to couple with G proteins and activate downstream signaling pathways.

For direct ligand binding studies, an intrinsic tryptophan fluorescence assay has proven effective . This technique measures changes in the fluorescence emission of tryptophan residues within the receptor upon ligand binding, allowing for quantification of binding affinity. Using this approach, researchers have determined that some olfactory receptors bind their cognate odorants with affinities in the micromolar range .

Additional methodologies include calcium imaging, which detects changes in intracellular calcium levels following receptor activation, and surface plasmon resonance (SPR) for real-time binding kinetics analysis. For comprehensive functional characterization, these methods should be combined with site-directed mutagenesis studies to identify specific amino acid residues involved in ligand recognition and G-protein coupling .

What analytical techniques are recommended for studying OR4B1 structure-function relationships?

Investigating structure-function relationships of OR4B1 requires a multi-faceted analytical approach. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) has been successfully employed to determine the oligomeric state of purified olfactory receptors, revealing the presence of both monomeric and dimeric forms . This information is crucial for understanding receptor function, as dimerization may affect ligand binding properties and signaling capabilities.

Circular dichroism (CD) spectroscopy provides essential data on secondary structure elements and proper folding of the purified receptor . The characteristic α-helical pattern expected for a seven-transmembrane protein should be observed if the receptor has maintained its native conformation during purification.

For deeper structural insights, advanced techniques such as X-ray crystallography, cryo-electron microscopy, and nuclear magnetic resonance (NMR) spectroscopy can be applied, though these methods present significant challenges for membrane proteins like OR4B1 . Computational approaches, including molecular modeling and docking simulations based on homology models, offer complementary information about potential ligand binding sites and receptor-ligand interactions .

Functional studies should be correlated with structural data through systematic mutagenesis of predicted binding pocket residues. This combined approach can elucidate the molecular determinants of odorant recognition specificity and help identify the structural basis for OR4B1's role in the olfactory system .

How can OR4B1 be situated within the broader human olfactory receptor family hierarchy?

OR4B1 belongs to the immense human olfactory receptor gene family, which comprises 339 intact genes and 297 pseudogenes distributed across 51 different loci on 21 chromosomes . This family is organized into 172 subfamilies based on sequence relationships, with members of the same subfamily sharing sequence similarities and likely recognizing structurally related odorants . To accurately position OR4B1 within this hierarchy, phylogenetic analysis should be performed using multiple sequence alignment tools and tree-building algorithms.

The OR4B subfamily represents a specific branch within this complex phylogeny. By analyzing sequence conservation patterns across species and comparing with olfactory receptors of known ligand specificity, researchers can gain insights into the potential odorant recognition profile of OR4B1 . For instance, if OR4B1 shares significant sequence homology with receptors known to detect specific chemical structures (such as aliphatic alcohols or aldehydes), this suggests potential recognition of similar odorant classes.

The genomic location of OR4B1 should also be considered, as ORs with related functions often cluster at the same chromosomal loci . The table below illustrates how different olfactory receptor loci correlate with recognition of specific odorant types:

LocusORAmino acid identity, %Odorant(s) recognizedPerceived odor
1q22OR2387LyralLemony, green
5q35.3IG783LimoneneLemon
9q34.11ID371I-carvoneSpearmint, caraway
11q12.1OR7382EugenolSpicy
11q12.1OR7476Ethyl vanillinVanilla
11q12.2OR912-93662-HeptanoneFruity
11p15.4S2574n-aliphatic alcoholsHerbal, woody, orange, rose

This positional information can provide clues about the functional specialization of OR4B1 and its potential role in detecting specific classes of odorants .

What strategies can overcome the challenges in identifying cognate ligands for OR4B1?

Deorphanizing OR4B1 (identifying its natural ligands) presents significant challenges due to the vast chemical space of potential odorants and the complex combinatorial coding in olfaction. A systematic approach combining high-throughput screening with targeted follow-up validation is recommended. Begin with a diverse odorant library representing major chemical classes (aldehydes, ketones, esters, alcohols, etc.) at various concentrations, screening for activation using cAMP or calcium flux assays in heterologous cells expressing OR4B1 .

Once initial hits are identified, perform structure-activity relationship (SAR) studies with chemical analogs to define the molecular features critical for receptor activation. This approach has successfully identified ligands for other olfactory receptors, revealing that some respond to a broad range of odorants while others are activated by a limited set of structurally related compounds .

Computational methods can complement experimental approaches. Homology modeling of OR4B1 based on related GPCRs, followed by in silico docking of potential ligands, can predict binding interactions and prioritize compounds for experimental testing . Additionally, comparing OR4B1 sequences across species may identify conserved residues likely involved in ligand recognition.

For validation, employ orthogonal assays such as direct binding measurements using purified receptor and intrinsic tryptophan fluorescence or surface plasmon resonance . The cognate ligand(s) should activate the receptor with affinities in the micromolar to nanomolar range, consistent with the typical sensitivity of the olfactory system .

How can gene editing techniques be applied to study OR4B1 function in native cellular contexts?

CRISPR-Cas9 and related gene editing technologies offer powerful approaches to investigate OR4B1 function in its native cellular environment. For in vitro studies using olfactory sensory neuron (OSN) cultures or olfactory epithelium organoids, CRISPR-Cas9 can be employed to knockout OR4B1, introduce point mutations in specific domains, or tag the endogenous protein with fluorescent reporters or affinity tags .

When designing CRISPR experiments, careful consideration of guide RNA specificity is essential to avoid off-target effects, particularly given the sequence similarities among olfactory receptor family members . Validation of editing efficiency should be performed using sequencing, and phenotypic consequences assessed through functional assays such as calcium imaging or electrophysiology in response to odorant stimulation.

For more complex studies exploring combinatorial effects, multiplexed CRISPR systems can target OR4B1 alongside genes involved in its signaling pathway or trafficking . This approach requires thoughtful experimental design with appropriate controls and statistical power calculations. As noted in search result , "Because we are considering a difference in fold changes between conditions (in essence a difference of differences), power is notably limited and the underlying data sets must be as consistent as possible, preferably lacking batch effects and other technical variation, or otherwise the sample size will need to be dramatically increased."

Advanced gene editing strategies such as base editing or prime editing offer precise modification of specific nucleotides without double-strand breaks, allowing for subtle alterations of OR4B1 sequence to probe structure-function relationships with minimal disruption to the genomic context .

What quality control measures are essential when working with recombinant OR4B1?

Rigorous quality control is crucial when working with recombinant OR4B1 to ensure reliable and reproducible results. Begin with sequence verification of the expression construct to confirm the absence of unwanted mutations. After expression, assess protein purity using SDS-PAGE and Western blotting with antibodies against the epitope tags . For purified receptor preparations, size exclusion chromatography profiles should show well-defined peaks corresponding to monomeric and potentially dimeric forms of the receptor .

Functional integrity must be verified through circular dichroism spectroscopy to confirm proper folding of the purified receptor . The CD spectrum should exhibit the characteristic pattern of a predominantly α-helical protein, consistent with the seven-transmembrane structure of olfactory receptors. Additionally, a ligand binding assay using a known agonist (if available) or putative ligands should demonstrate specific binding with expected affinity constants .

Mass spectrometry analysis can provide definitive confirmation of protein identity and reveal any post-translational modifications. For long-term storage, stability tests should be conducted under various conditions (temperature, buffer composition, freeze-thaw cycles) to establish optimal preservation protocols. Finally, batch-to-batch consistency should be monitored using standardized functional assays to ensure reproducibility across experiments .

How should experiments be designed to detect synergistic effects in OR4B1 signaling pathways?

Investigating synergistic effects in OR4B1 signaling requires careful experimental design and robust analytical frameworks. As highlighted in search result , when studying interactions between multiple perturbations (such as combinations of ligands or pathway modulators), it is essential to design experiments that can distinguish between additive and synergistic effects. This approach is particularly relevant for understanding how OR4B1 may participate in combinatorial odor coding.

The experimental design should include all possible combinations of the factors being tested (e.g., OR4B1 ligands, pathway modulators, genetic perturbations) along with appropriate controls. As noted in the literature, "Our experimental framework enables the study of gene-gene interaction (i.e., epistasis), gene-environment interactions, genotype-specific drug responses, and drug-drug interactions" .

For analysis, compare observed effects of combined perturbations against mathematical models of expected additive effects. Significant deviations from additivity indicate synergistic or antagonistic interactions. Statistical power calculations are crucial: "We include a function (Step 18) to calculate the number of samples necessary to be powered for a comparison of differences among them, validating the power of the current experiment and informing the design of subsequent ones" .

Minimize technical variation through careful experimental design, as "...power is notably limited and the underlying data sets must be as consistent as possible, preferably lacking batch effects and other technical variation, or otherwise the sample size will need to be dramatically increased" . Employ appropriate statistical methods for detecting interaction effects, such as two-way ANOVA or more sophisticated models for complex designs.

What are the most common technical challenges when characterizing OR4B1-ligand interactions and how can they be addressed?

Characterizing OR4B1-ligand interactions presents several technical challenges that require specific methodological solutions. First, the hydrophobic nature of olfactory receptors makes them difficult to express and purify in functional form. This can be addressed by optimizing detergent conditions during solubilization and purification, potentially incorporating lipid nanodiscs or other membrane mimetics to maintain native-like environments .

Low expression levels often limit the amount of purified receptor available for biophysical studies. Implementing optimized inducible expression systems with trafficking enhancement sequences can improve yields . Additionally, miniaturized assay formats that require less protein, such as microscale thermophoresis or biolayer interferometry, can be employed for binding studies.

Odorant volatility and water solubility pose challenges for consistent ligand delivery in assays. These issues can be mitigated by using sealed assay systems, controlling temperature, and employing appropriate solubilization methods (such as cyclodextrins) for hydrophobic odorants. For kinetic measurements, stopped-flow techniques or real-time detection systems with rapid mixing capabilities may be necessary.

Non-specific binding of hydrophobic odorants to assay components can generate false positives. Include appropriate negative controls, such as non-transfected cells or denatured receptor preparations, and consider using competitive binding assays with known ligands to confirm specificity. Finally, signal-to-noise ratios in functional assays may be improved by amplifying detection systems or employing more sensitive readouts such as BRET-based sensors for cAMP or calcium flux .

How might OR4B1 research contribute to broader understanding of olfactory coding principles?

OR4B1 research can provide valuable insights into the fundamental principles of olfactory coding by establishing its specific role within the combinatorial receptor array. Each olfactory receptor recognizes multiple odorants, and each odorant activates multiple receptors, creating a complex coding system. As noted in the literature, "Odor detection and coding by the OR family are combinatorial: each OR recognizes multiple odorants, but different odorants are detected, and thereby encoded, by different combinations of ORs" .

By comprehensively characterizing the ligand specificity profile of OR4B1 and comparing it with other receptors, researchers can identify patterns in receptor tuning that inform computational models of olfactory coding. Understanding whether OR4B1 has broad or narrow tuning properties will help classify it within the spectrum of receptor types that contribute to odor discrimination. If OR4B1 belongs to a specific subfamily dedicated to detecting particular odorant structures, this would support the hypothesis that "each subfamily may be dedicated to the detection of a particular class of odorant structures" .

Additionally, investigating OR4B1's genomic location and evolutionary history can reveal insights into how selective pressures have shaped the human olfactory receptor repertoire. Since "highly related ORs often reside at the same locus" , analyzing the chromosomal neighborhood of OR4B1 may uncover functional relationships with other receptors and help establish whether certain genomic regions are specialized for detecting specific odorant classes.

Through detailed structural characterization and receptor-ligand interaction studies, OR4B1 research can contribute to developing a molecular grammar of odorant recognition, advancing our understanding of how chemical structures are translated into perceptual experiences.

What emerging technologies could enhance OR4B1 structural and functional studies?

Several cutting-edge technologies are poised to revolutionize structural and functional studies of OR4B1 and other olfactory receptors. Cryo-electron microscopy (cryo-EM) has recently enabled breakthrough structural determinations of challenging membrane proteins and could potentially resolve OR4B1 structure at near-atomic resolution, especially when combined with novel stabilization strategies such as conformational locks or antibody fragments .

Single-particle analysis techniques, when applied to purified OR4B1 in various conformational states (ligand-free, ligand-bound, G-protein-coupled), could reveal the molecular mechanisms of receptor activation. Additionally, advanced NMR methodologies for membrane proteins, including solid-state NMR and selective isotope labeling approaches, offer complementary structural information about ligand binding sites and dynamic properties .

For functional characterization, long-term optical recording from living cells expressing OR4B1 using genetically encoded fluorescent sensors for cAMP or calcium would allow continuous monitoring of receptor activation under varying conditions. High-throughput microfluidic platforms capable of precisely controlling odorant delivery could significantly accelerate ligand screening efforts and enable detailed dose-response analyses.

Integrating artificial intelligence approaches, particularly deep learning algorithms trained on existing olfactory receptor-ligand data, could predict potential OR4B1 ligands and guide experimental testing. Furthermore, advanced computational simulation techniques, including long-timescale molecular dynamics with enhanced sampling methods, could model conformational changes associated with OR4B1 activation and provide testable hypotheses about structure-function relationships .

How can comparative genomics approaches enhance our understanding of OR4B1 evolution and function?

Comparative genomics offers powerful strategies for elucidating OR4B1 evolution and functional specialization across species. By analyzing OR4B1 orthologs from diverse mammals, researchers can identify highly conserved residues likely critical for structural integrity or fundamental receptor functions. Conversely, rapidly evolving sites may indicate regions under positive selection that contribute to species-specific odorant detection capabilities.

The significant sequence divergence between human OR4B1 and its rodent orthologs (55% sequence identity) suggests potential functional differences that may correlate with ecological adaptations. Synthesizing recombinant versions of OR4B1 orthologs from multiple species and comparing their ligand response profiles can reveal how evolutionary pressures have shaped receptor function in different ecological niches.

Whole-genome sequencing approaches can identify runs of homozygosity (ROHs) that may include OR4B1, potentially indicating selective sweeps or population bottlenecks that affected this gene . As noted in recent research, "whole genome sequencing uncovers very short ROH segments that genotyping arrays fail to detect" , providing more comprehensive detection of genomic patterns relevant to OR evolution.

Functional genomics tools, such as single-cell RNA sequencing of olfactory sensory neurons across species, can determine whether OR4B1 expression patterns have diverged along with sequence changes. This multi-level comparative approach—spanning sequence, structure, and expression—provides a comprehensive framework for understanding how OR4B1 has evolved to fulfill specific sensory functions in humans versus other mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.