Recombinant Human Olfactory receptor 4C11 (OR4C11)

Shipped with Ice Packs
In Stock

Description

Molecular and Genomic Characteristics

OR4C11 is located on chromosome 11 (11q12.1) in humans and spans 310 amino acids . The recombinant protein retains the native seven-transmembrane domain structure critical for odorant binding and signal transduction . Key features include:

PropertyDetails
Gene ID219429
UniProt IDQ6IEV9
Molecular Weight~35 kDa
SequenceIncludes motifs GN, MAYDRYVAIC, KAFSTCASH, and PMLNPFIY
Chromosomal Location11q12.1 (GRCh38.p14 assembly)

Functional Role

OR4C11 is implicated in:

  • Odorant Detection: Binds structurally diverse odorants through combinatorial coding .

  • G Protein-Coupled Signaling: Activates downstream pathways upon odorant binding .

  • Chemical Interaction: Modulated by compounds such as bisphenol A, acrylamide, and sodium arsenite, which alter its expression .

Production and Purification

Recombinant OR4C11 is produced using advanced expression systems:

  • Expression Hosts: Escherichia coli and cell-free systems (e.g., ALiCE®) .

  • Purification: Strep-tag affinity chromatography achieves >70–80% purity .

  • Storage: Lyophilized or liquid forms stable at -80°C for 12 months .

Applications in Research

ApplicationDetails
ELISA KitsQuantifies OR4C11 in biological samples (sensitivity: 0.156–10 ng/mL) .
Functional StudiesUsed to investigate odorant-receptor interactions and signaling mechanisms .
Chemical ScreeningIdentifies ligands and modulators via high-throughput assays .

Subfamily and Odorant Specificity

OR4C11 belongs to the olfactory receptor subfamily 4C, which detects odorants with aliphatic or aromatic structures . Key findings include:

  • Subfamily Composition: Humans possess 172 OR subfamilies, with OR4C11 encoded at a single locus (11q12.1) .

  • Chemical Interactions:

    ChemicalEffect on OR4C11Study
    Bisphenol AAlters mRNA expressionPMID:25181051
    Sodium GlutamateDecreases expression (synergistic with fructose)PMID:20111022
    AcrylamideReduces mRNA levelsPMID:28959563

Evolutionary Conservation

OR4C11 shares homology with rodent orthologs, suggesting conserved roles in odor detection . Copy-number variations in OR genes, including OR4C11, correlate with individual differences in olfactory perception .

Future Directions

Current research focuses on:

  • Structural Analysis: Resolving 3D conformations to identify binding pockets .

  • Pathway Mapping: Elucidating OR4C11’s role in non-olfactory tissues (e.g., brain, testes) .

  • Therapeutic Potential: Targeting OR4C11 for diseases linked to olfactory dysfunction .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format preference, kindly indicate your requirement when placing the order, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4C11; OR4C11P; Olfactory receptor 4C11; Olfactory receptor OR11-136
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4C11
Target Protein Sequence
MQQNNSVPEFILLGLTQDPLRQKIVFVIFLIFYMGTVVGNMLIIVTIKSSRTLGSPMYFF LFYLSFADSCFSTSTAPRLIVDALSEKKIITYNECMTQVFALHLFGCMEIFVLILMAVDR YVAICKPLRYPTIMSQQVCIILIVLAWIGSLIHSTAQIILALRLPFCGPYLIDHYCCDLQ PLLKLACMDTYMINLLLVSNSGAICSSSFMILIISYIVILHSLRNHSAKGKKKALSACTS HIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLW HGKIISENKG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15167

KEGG: hsa:219429

STRING: 9606.ENSP00000306651

UniGene: Hs.553620

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What genomic characteristics define OR4C11?

OR4C11 is located on human chromosome 11q11, in a region that is olfactory receptor-rich. This gene is part of the largest gene family in the human genome - the olfactory receptor gene family . OR4C11 is also known by several synonyms including OR11-136 and OR4C11P .

The gene has been identified in copy number variation (CNV) studies, indicating that it can be present in different copy numbers across individuals. Interestingly, OR4C11 is located in a genomic region that shows significant CNV clustering, suggesting that this area is particularly prone to structural variations .

What techniques are most effective for detecting OR4C11 copy number variations?

Several complementary techniques have proven effective for detecting OR4C11 copy number variations:

  • Microarray-based approaches: High-resolution oligonucleotide tiling microarrays have been successfully employed to detect CNVs affecting OR4C11. This methodology involves comparing genomic DNA from test individuals against control samples using quantile normalization and log2-ratio calculations. A threshold of ±0.18 in normalized intensity ratios has been shown to effectively identify CNVs with a false positive rate of <4% .

  • Quantitative PCR (qPCR): This method serves as an effective validation tool for CNVs initially identified through microarray experiments. When designing qPCR primers for OR4C11, researchers should carefully consider regions of high sequence similarity with other olfactory receptor genes to ensure specificity .

  • Multiplex Amplicon Quantification (MAQ): This technique has been specifically applied to screen for copy number variants at chromosome 11q11 in the context of studying OR4C11's relationship to obesity. MAQ offers the advantage of processing multiple samples simultaneously, increasing throughput for population studies .

  • Conventional PCR: This method is particularly useful for confirming homozygous deletions identified by qPCR. Designing primers that flank the suspected deletion boundaries can validate the presence of specific deletion alleles .

How can researchers effectively express and purify recombinant OR4C11 protein?

Expression and purification of recombinant OR4C11 present several challenges due to its transmembrane nature. Based on existing protocols, the following methodology has proven successful:

  • Expression system selection: E. coli has been successfully used as an expression system for recombinant OR4C11. This approach typically involves creating a construct with the full-length protein (amino acids 1-310) fused to an N-terminal His-tag .

  • Purification strategy: Affinity chromatography using the His-tag is the primary purification method. The purified protein typically achieves >90% purity as determined by SDS-PAGE .

  • Storage considerations: The purified protein should be stored as a lyophilized powder. For working solutions, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

  • Stability management: Repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week. For extended storage, the protein should be conserved at -20°C or -80°C .

How do copy number variants of OR4C11 contribute to obesity risk?

Research has established a significant association between copy number variants affecting OR4C11 and obesity risk. The mechanism involves:

  • Structural variation impact: A specific ±80 kb deletion with an internally 1.3 kb retained segment has been identified, covering OR4C11 along with two other olfactory receptor genes (OR4P4 and OR4S2). This deletion shows a significantly increased frequency in patients with obesity (MAF = 27%, p = 0.02) .

  • Metabolic pathway influence: Expression profiling has demonstrated that OR4C11 is present in both visceral and subcutaneous adipose tissue, supporting the 'metabolic system' hypothesis. This suggests that gene disruption of OR4C11 negatively influences energy metabolism, potentially leading to fat accumulation and obesity .

  • Functional mechanism: The disruption of OR4C11 and related genes appears to affect olfactory signaling pathways that influence food intake and energy balance. Olfactory receptors may play unexpected roles outside the nasal epithelium, particularly in metabolic tissues .

What is known about protein interactions involving OR4C11?

OR4C11 has been reported to engage in direct interactions with various proteins and molecules. These interactions have been detected through multiple experimental approaches:

How do genomic "hotspots" affect OR4C11 copy number variation?

OR4C11 is located in a genomic region characterized as a CNV "hotspot," which has significant implications for research:

  • Non-uniform distribution: CNVs affecting OR loci, including OR4C11, show a strong non-uniform distribution, clustering into genomic hotspots. This clustering demonstrates a strong correlation (0.8, P-value = 10^-18) between the variance of a variable OR and the variance of adjacently located ORs .

  • Formation mechanisms: Several mechanisms contribute to this clustering phenomenon:

    • Enrichment of CNVs near telomeres and centromeres

    • Genomic CNV formation biases

    • Non-allelic homologous recombination (NAHR) between OR genes

    • Evolutionary selection pressures

  • Deletion alleles: OR4C11 is specifically affected by "deletion I," which spans 82.6 kb on chromosome 11q11 and includes five other OR genes/pseudogenes (OR4P4, OR4S2, OR4C6, OR4V1P, OR4P1P). This deletion has an estimated allele frequency of 0.36 in the studied population .

How can researchers differentiate between OR4C11 and closely related olfactory receptors?

Differentiating OR4C11 from closely related olfactory receptors presents significant challenges due to high sequence homology. Researchers can employ the following strategies:

  • Sequence-specific primers: Design PCR primers targeting unique regions of OR4C11, particularly focusing on areas with sequence divergence from paralogs. Careful bioinformatic analysis of sequence alignments is essential for identifying these regions .

  • Allele-specific qPCR: This approach can effectively distinguish between OR4C11 and its close relatives. By designing primers at the interface of recombination regions, researchers can identify specific variants .

  • High-resolution genomic approaches: Tiling microarrays with dense probe coverage can assist in resolving ambiguities between closely related OR genes. This approach is particularly valuable when studying genomic regions prone to NAHR events .

  • Evolutionary analysis: Understanding the evolutionary relationships between OR4C11 and other olfactory receptors can provide insights into functional divergence. For instance, OR4C11 has been involved in fusion events with other OR genes, such as the case where OR8U8 and OR8U9 fused through NAHR to form the chimeric gene OR8U1 .

What experimental designs are optimal for studying OR4C11 expression in adipose tissue?

Based on recent research linking OR4C11 to obesity, the following experimental approaches are recommended for studying its expression in adipose tissue:

  • Tissue selection: Both visceral and subcutaneous adipose tissue samples should be included in study designs, as OR4C11 has been detected in both types. Liver tissue serves as an important negative control, as OR4C11 expression has not been detected there .

  • Expression profiling methodology:

    • RT-qPCR with gene-specific primers for accurate quantification

    • RNA-seq for comprehensive transcriptomic analysis

    • In situ hybridization to visualize tissue-specific expression patterns

  • Experimental comparisons: Studies should include adipose tissue samples from both obese and non-obese subjects to correlate expression levels with metabolic phenotypes. Additionally, samples from individuals with different copy number states of OR4C11 should be compared to understand dosage effects .

  • Functional validation: To move beyond correlative observations, knockdown or overexpression of OR4C11 in adipocyte cell models can help establish causative relationships between expression levels and metabolic parameters .

How might OR4C11 be involved in non-olfactory physiological processes?

The discovery of OR4C11 expression in adipose tissue opens new research questions about its non-canonical functions:

  • Metabolic regulation: The association between OR4C11 CNVs and obesity suggests potential roles in energy homeostasis, possibly through sensing metabolites or fatty acids in adipose tissue .

  • Cross-talk with metabolic pathways: OR4C11 may interact with metabolic signaling networks, potentially influencing lipid metabolism or adipokine secretion. Research designs should incorporate pathway analysis to identify these connections .

  • Population variation: Given the established copy number variation of OR4C11, population studies may reveal differential metabolic effects across ethnic groups or geographical regions. This presents an opportunity for translational research connecting genomic variation to clinical outcomes .

What approaches can determine the specific odorant ligands for OR4C11?

Identifying specific odorant ligands for OR4C11 requires specialized techniques:

  • Heterologous expression systems: Expression of OR4C11 in systems such as HEK293 cells coupled with calcium imaging or cAMP assays can screen potential ligands. The recombinant OR4C11 protein with His-tag could facilitate such studies .

  • Structure-based computational modeling: Using the known amino acid sequence of OR4C11, computational approaches can predict binding pocket characteristics and potential ligand interactions. The 7-transmembrane domain structure is particularly important for these analyses .

  • High-throughput screening: Libraries of odorant molecules can be systematically tested against cells expressing OR4C11 to identify activating compounds. Automated platforms combining robotics with functional readouts offer efficient screening capabilities.

  • Cross-species comparative analysis: Examination of OR4C11 orthologs in other species may provide evolutionary insights into conserved ligand preferences, contributing to understanding of functional significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.