Recombinant Human Olfactory receptor 4C12 (OR4C12)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant OR4C12 is produced using heterologous expression platforms to enable functional and structural studies:

Host SystemDetails
Escherichia coliCost-effective for large-scale production but may lack post-translational modifications .
HEK293 CellsMammalian system preserves native folding and ligand-binding activity .
BaculovirusInsect cell systems balance yield and protein quality .

Tagging strategies (e.g., N-terminal FLAG, C-terminal rho1D4 epitopes) are employed to facilitate purification and detection .

Functional Assays and Ligand Binding

Functional characterization of OR4C12 remains nascent, but analogous studies on other ORs highlight common approaches:

  • Calcium Imaging: Measures intracellular Ca²⁺ flux upon ligand binding .

  • Intrinsic Tryptophan Fluorescence: Quantifies ligand affinity (e.g., micromolar-range binding observed for hOR1A1) .

  • Western Blot (WB): Anti-OR4C12 antibodies (e.g., Boster Bio #A16635) validate expression, with working dilutions of 1:500–1:2000 .

No specific ligands for OR4C12 have been identified to date, underscoring its status as an orphan receptor .

Research Challenges and Future Directions

Key gaps persist:

  1. Ligand Discovery: High-throughput screening is needed to deorphanize OR4C12 .

  2. Structural Resolution: Cryo-EM or X-ray crystallography could elucidate activation mechanisms .

  3. In Vivo Function: Role in non-olfactory tissues (e.g., sperm chemotaxis) warrants exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR4C12; Olfactory receptor 4C12; Olfactory receptor OR11-259
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4C12
Target Protein Sequence
MEKKKNVTEFILIGLTQNPIMEKVTFVVFLVLYMITLSGNLLIVVTITTSQALSSPMYFF LTHLSLIDTVYSSSSAPKLIVDSFQEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDC YVAICKPLNYTTIMSHSLCILLVAVAWVGGFLHATIQILFTVWLPFCGPNVIGHFMCDLY PLLKLVCIDTHTLGLFVAVNSGFICLLNFLILVVSYVIILRSLKNNSLEGRCKALSTCIS HIIVVVLFFVPCIFVYLRSVTTLPIDKAVAVFYTMVVPMLNPVVYTLRNAEVKSAIRKLW RKKVTSDND
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15168

KEGG: hsa:283093

STRING: 9606.ENSP00000334418

UniGene: Hs.553669

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4C12 and what is its role in human physiology?

OR4C12 (olfactory receptor family 4 subfamily C member 12) is a human gene that encodes the olfactory receptor 4C12 protein. This protein belongs to the large family of G-protein-coupled receptors (GPCRs) and is specifically involved in the sense of smell. It functions by interacting with odorant molecules in the nasal epithelium to initiate neuronal responses that trigger smell perception .

The protein features a characteristic 7-transmembrane domain structure, which is common among GPCRs including neurotransmitter and hormone receptors. OR4C12 is responsible for the recognition and G protein-mediated transduction of odorant signals, contributing to the complex process of smell discrimination in humans .

Where is the OR4C12 gene located in the human genome?

The OR4C12 gene is located on chromosome 11 in the human genome . It is part of the olfactory receptor gene family, which is notable for being the largest gene family in the human genome. OR4C12 is also known by the alternative name OR11-259 .

The gene encodes a functional protein that participates in the olfactory signaling pathway. As with other olfactory receptor genes, OR4C12 arises from a single coding-exon gene, which is a characteristic feature of this gene family .

What is the structural composition of the OR4C12 protein?

The OR4C12 protein exhibits the classic 7-transmembrane domain structure typical of G-protein-coupled receptors. Based on detailed protein sequence analysis, the structure includes:

  • An N-terminal domain (extracellular)

  • Seven transmembrane domains (TM1-TM7) that span the cell membrane

  • Three intracellular loops (ICL1-ICL3) connecting the transmembrane domains on the cytoplasmic side

  • Three extracellular loops (ECL1-ECL3) connecting the transmembrane domains on the extracellular side

  • A C-terminal domain (intracellular) that includes helix 8 (H8)

The complete amino acid sequence consists of approximately 309 amino acids, with specific structural elements arranged in a pattern characteristic of olfactory receptors .

How does OR4C12 activation mechanism compare to other olfactory receptors?

OR4C12 functions through the canonical signaling mechanism shared by most olfactory receptors, but with potential receptor-specific variations that remain under investigation. The activation process begins when an odorant molecule binds to the receptor's binding pocket, likely formed by the transmembrane domains, particularly TM3, TM5, and TM6 .

This binding induces a conformational change in the receptor structure, enabling the activation of associated G proteins (typically Golf in olfactory neurons). The activated G protein then triggers the adenylyl cyclase signaling cascade, leading to an increase in intracellular cAMP, opening of cyclic nucleotide-gated channels, and ultimately resulting in neuronal depolarization and signal transduction .

What distinguishes OR4C12 from other olfactory receptors is its specific odorant recognition profile, which is determined by the unique amino acid composition of its binding pocket. While the general activation mechanism follows the GPCR paradigm, the specificity for particular odorants and the downstream signaling efficiency may vary significantly from other olfactory receptors .

What experimental challenges are associated with expressing functional OR4C12 in heterologous systems?

Expressing functional OR4C12 in heterologous systems presents several significant challenges:

ChallengeDescriptionPotential Solutions
Poor surface expressionMany olfactory receptors, including OR4C12, show limited trafficking to the plasma membrane in heterologous cellsUtilize receptor transport proteins (RTPs); Create fusion constructs with well-expressed GPCRs; Use specialized expression vectors
Protein misfoldingThe complex 7-TM structure can lead to misfolding in non-native environmentsOptimize culture conditions (temperature, additives); Use chaperone co-expression systems
Ligand identificationWithout known ligands, functional validation is difficultEmploy high-throughput screening approaches; Use computational prediction models based on OR4C12's sequence
Signal transduction couplingHeterologous systems may lack appropriate G protein couplingCo-express appropriate G proteins (Golf); Use chimeric G proteins for enhanced coupling

These challenges necessitate careful experimental design when working with OR4C12 in laboratory settings. Successful expression often requires a combination of approaches tailored to the specific research question and cellular context .

What is known about the ligand specificity of OR4C12 and how might it be determined?

Currently, no specific physiological ligands have been definitively identified for OR4C12 based on the available search results . This knowledge gap represents a significant research opportunity.

Determining ligand specificity for OR4C12 would likely require a multi-faceted approach:

  • Computational Prediction Methods:

    • Homology modeling based on the 7-TM structure

    • Molecular docking simulations with potential odorants

    • Machine learning approaches using known ligand-receptor pairs from related olfactory receptors

  • Experimental Validation Techniques:

    • Calcium imaging assays in transfected cells

    • cAMP accumulation measurements

    • Electrophysiological recordings (patch-clamp)

    • Bioluminescence resonance energy transfer (BRET) assays to measure conformational changes

  • High-throughput Screening:

    • Library screening of diverse odorant molecules

    • Assessment of structure-activity relationships

    • Deorphanization strategies using focused compound collections

The identification of specific ligands would significantly advance understanding of OR4C12's physiological role and potentially reveal unique signaling properties compared to other olfactory receptors .

What are the best approaches for producing high-quality recombinant OR4C12 for structural studies?

Producing high-quality recombinant OR4C12 for structural studies requires specialized approaches to overcome the inherent challenges of membrane protein expression and purification:

  • Expression System Selection:

    • Insect cell systems (Sf9, High Five) often provide superior expression for GPCRs

    • Mammalian cell lines (HEK293, CHO) with inducible expression systems

    • Cell-free expression systems for direct incorporation into nanodiscs or lipid environments

  • Construct Optimization:

    • Addition of N-terminal signal sequences to enhance membrane targeting

    • Introduction of thermostabilizing mutations based on computational prediction

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL) to stabilize flexible regions

    • Truncation of disordered N- and C-terminal regions while preserving functional integrity

  • Purification Strategy:

    • Two-step affinity purification using tandem tags (His-tag plus FLAG or other epitope tag)

    • Size exclusion chromatography to ensure homogeneity

    • Lipid composition optimization during solubilization and purification

    • Detergent screening to identify optimal micelle environments

  • Quality Assessment:

    • Circular dichroism to verify secondary structure integrity

    • Thermal stability assays to assess protein folding

    • Single-particle analysis methods prior to structural studies

    • Ligand binding assays to confirm functional activity

These methodologies must be carefully optimized for OR4C12 specifically, as conditions successful for other GPCRs may not be directly transferable .

How can researchers effectively validate the functional activity of recombinant OR4C12?

Validating the functional activity of recombinant OR4C12 requires multiple complementary approaches to confirm proper folding, membrane integration, and signaling capabilities:

  • Binding Assays:

    • Radioligand binding using tritiated or iodinated ligands (once identified)

    • Fluorescent ligand binding measured by microscopy or flow cytometry

    • Surface plasmon resonance (SPR) or microscale thermophoresis for label-free binding kinetics

  • Signaling Assays:

    • FLIPR-based calcium mobilization assays in transfected cells

    • cAMP accumulation measured with ELISA or BRET-based sensors

    • IP1 accumulation assays to assess Gq-coupling if relevant

    • β-arrestin recruitment assays using enzyme complementation or BRET

  • Trafficking and Expression Validation:

    • Immunofluorescence microscopy to confirm membrane localization

    • Flow cytometry with anti-tag antibodies to quantify surface expression

    • Western blotting to verify protein integrity and expression levels

    • Glycosylation analysis to confirm proper processing

  • Functional Reconstitution:

    • GTPγS binding assays with purified components

    • Reconstitution in proteoliposomes for direct functional assessment

    • Planar lipid bilayer electrical recordings if ion channel coupling is suspected

A comprehensive validation approach would incorporate multiple methods to build confidence in the functionality of the recombinant receptor, especially important given the challenges associated with expressing olfactory receptors in heterologous systems .

What strategies can be employed for identifying physiological ligands of OR4C12?

Identifying physiological ligands for OR4C12 requires systematic deorphanization strategies:

  • Hypothesis-Driven Approaches:

    • Phylogenetic analysis to identify closely related ORs with known ligands

    • Structural modeling to predict binding pocket characteristics

    • Virtual screening against libraries of known odorants based on structural models

    • Testing compounds based on sequence similarity to receptors with known ligands

  • High-Throughput Screening Methods:

    • Functional cell-based assays using reporter systems (calcium, cAMP)

    • Screening of diverse odorant libraries organized by chemical class

    • Multiplexed assay systems to test multiple conditions simultaneously

    • Concentration-response testing for hits to determine potency

  • Novel Tissue-Based Approaches:

    • Ex vivo tissue preparations from olfactory epithelium

    • Single-cell RNA sequencing to correlate receptor expression with functional responses

    • Transgenic models with labeled OR4C12-expressing neurons

    • Calcium imaging of primary olfactory sensory neurons

  • Data Integration and Analysis:

    • Structure-activity relationship development for responsive compounds

    • Machine learning approaches to predict additional ligands based on initial hits

    • Molecular dynamics simulations to understand binding modes

    • Correlation of chemical properties with activation potentials

The absence of known physiological ligands for OR4C12 makes this a particularly valuable research direction, potentially revealing new insights into odorant perception and the specific role of this receptor in the olfactory system .

How might OR4C12 research contribute to understanding olfactory coding and perception?

Research on OR4C12 can significantly advance our understanding of olfactory coding and perception through several avenues:

OR4C12, as a member of the largest gene family in the human genome, represents an important piece in decoding how humans perceive and discriminate thousands of odors with a limited number of receptors. By characterizing its ligand binding profile, researchers can gain insights into how the olfactory system achieves its remarkable combinatorial coding efficiency .

The specific response profile of OR4C12 may reveal unique contributions to particular odor perceptions. If its ligands can be identified, this would add to our understanding of the complex mapping between molecular structures and odor qualities. Furthermore, investigating OR4C12's signal transduction properties could illuminate receptor-specific variations in signaling intensity or duration that contribute to the nuanced perception of odors .

Comparative genomic studies involving OR4C12 might also reveal evolutionary adaptations in human olfactory perception compared to other species. The conservation or divergence of this receptor across different populations could provide insights into the genetic basis of individual differences in smell perception .

What role might OR4C12 play in personalized medicine approaches?

OR4C12 research has several potential implications for personalized medicine:

Genetic variations in OR4C12 may contribute to individual differences in odor perception, which could impact quality of life, food preferences, and even response to certain environments or therapies. Identifying such variations could enable personalized approaches to addressing olfactory disorders or optimizing treatments where smell perception plays a role .

The olfactory system has connections to neurodegenerative diseases, with olfactory dysfunction often preceding other symptoms in conditions like Parkinson's and Alzheimer's disease. Understanding the specific involvement of receptors like OR4C12 in these conditions could potentially lead to early diagnostic tools or therapeutic targets .

Additionally, as a GPCR, OR4C12 shares structural and functional similarities with many drug targets. Research on its structure and signaling mechanisms could inform drug discovery efforts for other GPCRs, potentially enabling more personalized pharmacological interventions for a range of conditions .

What technical innovations could advance OR4C12 research in the next decade?

Several emerging technologies and approaches could significantly advance OR4C12 research:

TechnologyPotential ApplicationImpact on OR4C12 Research
Cryo-EM advancesHigh-resolution structural determinationReveal detailed binding pocket architecture and conformational changes
AI-driven protein structure predictionImproved modeling of OR4C12 without crystal structuresAccelerate ligand prediction and structure-function studies
Single-cell transcriptomicsPrecise characterization of OR4C12-expressing cellsBetter understanding of receptor expression patterns and co-expression networks
CRISPR-Cas9 genetic engineeringGeneration of reporter systems and humanized animal modelsMore precise functional studies in relevant physiological contexts
Organ-on-chip technologyCreation of olfactory epithelium modelsTesting OR4C12 function in more physiologically relevant systems
Advanced computational screeningVirtual high-throughput ligand discoveryIdentification of novel ligands and pharmacological tools

These innovations could overcome many current limitations in OR4C12 research, particularly the challenges of heterologous expression and the lack of identified physiological ligands. The combination of structural biology advances with computational approaches is especially promising for accelerating progress in understanding this receptor's function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.