Recombinant Human Olfactory receptor 4C13 (OR4C13)

Shipped with Ice Packs
In Stock

Description

Overview of OR4C13

Olfactory receptor 4C13 (OR4C13) is a class II G protein-coupled receptor (GPCR) encoded by the OR4C13 gene located on chromosome 11p11.12 in humans. As part of the olfactory receptor family—the largest GPCR family in the human genome—OR4C13 plays a role in odorant detection and signal transduction . While its specific ligands remain unidentified, OR4C13 shares structural and functional characteristics with other olfactory receptors, including a seven-transmembrane domain and activation via odorant-induced G-protein signaling .

Key Genomic and Proteomic Features:

PropertyDetails
Gene ID283092 (NCBI)
Chromosomal Location11p11.12
Exons1
Protein Length~34 kDa (predicted)
Tissue ExpressionTestis, epididymis, sperm cells (highest expression)

Recombinant Production and Expression

Recombinant OR4C13 refers to the protein produced in heterologous systems (e.g., HEK293 cells) for structural and functional studies. While direct data on recombinant OR4C13 is limited, insights can be extrapolated from studies on related olfactory receptors:

Common Strategies for Recombinant OR Expression :

  • Host Systems: HEK293S, Hana3A (modified with chaperones like RTP1/2 for proper folding).

  • Epitope Tags: N-terminal FLAG or C-terminal rho1D4 tags for purification and detection.

  • Purification: Immunoaffinity chromatography followed by gel filtration.

Challenges:

  • Low yield due to instability in detergent-solubilized forms .

  • Dimerization observed in other ORs (e.g., hOR1A1), complicating crystallization efforts .

Role in Reproduction:

OR4C13 is prominently expressed in male reproductive tissues:

  • Sperm Cells: Localized to the acrosome, midpiece, and flagellum, suggesting roles in motility or chemotaxis .

  • Testis and Epididymis: Expressed in spermatogonia, spermatocytes, and epididymal epithelium, implicating involvement in sperm maturation .

Ligand Binding Mechanisms:

While OR4C13’s ligands are unknown, olfactory receptors generally exhibit:

  • Broad Tuning: Activation by structurally related odorants.

  • Metal Ion Dependency: Copper or zinc ions may stabilize ligand interactions in some ORs .

Experimental Evidence:

  • Proteomic Identification: OR4C13 was detected in human seminal plasma and sperm cells via mass spectrometry .

  • Antibody Validation: Commercial antibodies (e.g., SAB4501233) confirm protein expression in reproductive tissues .

Potential Applications:

AreaRelevance
Fertility ResearchStudying OR4C13’s role in sperm maturation or idiopathic infertility .
Drug DiscoveryTargeting OR4C13 for male reproductive disorders (limited by ligand gaps) .

Challenges and Knowledge Gaps

  • Deorphanization: No known ligands or specific agonists/antagonists .

  • Structural Data: No resolved crystal or cryo-EM structures for OR4C13.

  • Functional Assays: Limited due to low recombinant expression efficiency .

Future Directions

  1. Ligand Screening: High-throughput assays to identify OR4C13-activating compounds.

  2. Structural Studies: Cryo-EM analysis of purified recombinant OR4C13.

  3. Clinical Correlations: Investigate OR4C13 expression in infertility cases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4C13; Olfactory receptor 4C13; Olfactory receptor OR11-260
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4C13
Target Protein Sequence
MANRNNVTEFILLGLTENPKMQKIIFVVFSVIYINAMIGNVLIVVTITASPSLRSPMYFF LAYLSFIDACYSSVNTPKLITDSLYENKTILFNGCMTQVFGEHFFRGVEVILLTVMAYDH YVAICKPLHYTTVMKQHVCSLLVGVSWVGGFLHATIQILFICQLPFCGPNVIDHFMCDLY TLINLACTNTHTLGLFIAANSGFICLLNCLLLLVSCVVILYSLKTHSLEARHEALSTCVS HITVVILSFIPCIFVYMRPPATLPIDKAVAVFYTMITSMLNPLIYTLRNAQMKNAIRKLC SRKAISSVK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15169

KEGG: hsa:283092

STRING: 9606.ENSP00000452277

UniGene: Hs.553668

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4C13 and what is its role in the human olfactory system?

Olfactory receptor 4C13 (OR4C13) is a protein encoded by the OR4C13 gene in humans. It belongs to the largest gene family in the genome - the olfactory receptor family. Like other olfactory receptors, OR4C13 functions as a G-protein-coupled receptor (GPCR) with a characteristic 7-transmembrane domain structure, similar to many neurotransmitter and hormone receptors .

OR4C13 plays a crucial role in the initial steps of olfactory signal transduction. When odorant molecules bind to this receptor in the nasal epithelium, it triggers a neuronal response that initiates the perception of specific smells . The receptor is responsible for both the recognition of odor molecules and the subsequent G protein-mediated transduction of these odorant signals .

Each olfactory receptor, including OR4C13, is thought to respond to a limited subset of odorants, contributing to the combinatorial coding scheme that allows humans to distinguish thousands of different odors despite having a more limited number of receptor types.

How does the structure of OR4C13 compare to other characterized olfactory receptors?

OR4C13, like other olfactory receptors, is a member of the G-protein-coupled receptor (GPCR) superfamily and shares the characteristic seven-transmembrane domain structure that is common to this class of proteins . The gene encoding OR4C13 arises from a single coding-exon, which is a typical feature of olfactory receptor genes .

While detailed structural information specifically for OR4C13 is limited in the current literature, comparative analysis with better-characterized olfactory receptors like OR17-40 suggests several structural features:

  • OR4C13 likely contains conserved domains that are characteristic of the olfactory receptor family, alongside regions of sequence diversity that contribute to its specific odorant-binding properties .

  • The transmembrane domains likely form a pocket where odorant binding occurs, with the specific amino acid composition of this pocket determining the receptor's ligand specificity.

  • As part of the olfactory receptor classification system, OR4C13 belongs to the Class II (tetrapod-specific) receptors rather than the Class I (fish-like) receptors .

The nomenclature assigned to OR4C13, like other olfactory receptor genes and proteins, is independent of other organisms, reflecting the species-specific evolution of these receptors .

What expression systems have been successfully used for recombinant olfactory receptors?

While specific expression data for OR4C13 is limited in the provided search results, the successful expression systems for other human olfactory receptors provide valuable methodological precedents:

Human Embryonic Kidney 293 (HEK293) cells have been effectively used for both transient and stable expression of human olfactory receptors. For instance, the human olfactory receptor OR17-40 was successfully expressed in HEK293 cells, demonstrating that this system can maintain the functional integrity of human olfactory receptors . Both transient transfection using calcium phosphate precipitation techniques and stable transfection with G418 selection have proven effective .

Xenopus laevis oocytes represent another viable expression system for human olfactory receptors. OR17-40 was functionally expressed in these oocytes following cytoplasmic injection of cRNA. This system allows for electrophysiological recording of receptor responses using two-electrode voltage clamp techniques .

When expressing recombinant olfactory receptors, researchers have enhanced membrane targeting and expression efficiency by:

  • Using membrane import sequences, such as the 5-HT3 receptor sequence

  • Including epitope tags (e.g., c-myc) for detection

  • Optimizing codon usage for the expression system

  • Co-expressing accessory proteins that facilitate proper folding and trafficking

These approaches could be adapted specifically for OR4C13 expression, potentially using constructs similar to the pSMyc vector system described for OR17-40 .

What methodologies are most effective for determining OR4C13 ligand specificity?

Determining ligand specificity for olfactory receptors like OR4C13 requires systematic approaches similar to those that have been successful with other human olfactory receptors:

The systematic deorphanization strategy demonstrated with OR17-40 provides an excellent methodological template . This approach involves:

  • Initial screening with diverse odorant mixtures (such as the Henkel 100 mixture used for OR17-40) to identify potential activating compounds .

  • Progressive subdivision of effective mixtures into smaller groups to isolate individual active components. For OR17-40, this approach identified helional as the primary ligand .

  • Structure-activity relationship analysis using structurally related molecules to define the chemical features required for receptor activation. In the case of OR17-40, only helional and the closely related heliotroplyacetone activated the receptor, while structurally similar compounds like piperonal, safrole, and vanillin were ineffective .

For functional analysis of OR4C13 responses, complementary techniques should be employed:

  • Calcium imaging in heterologous expression systems (like HEK293 cells) to measure transient increases in intracellular calcium concentration in response to potential ligands .

  • Electrophysiological recording techniques, especially when using systems like Xenopus oocytes, to measure conductance changes in response to odorant application .

  • Reporter gene assays that couple receptor activation to easily measurable outputs like luciferase expression.

The integration of these approaches, following the example set by successful characterization of other human olfactory receptors, would provide comprehensive data on OR4C13 ligand specificity.

How can conflicting data about OR4C13 ligand interactions be reconciled?

Reconciling conflicting data about OR4C13 ligand interactions requires a systematic approach to identify sources of variability and establish reproducible findings:

  • Expression system considerations: Different heterologous systems may produce varying results. When comparing data across studies, it's essential to consider whether OR4C13 was expressed in HEK293 cells, Xenopus oocytes, or other systems . The functional properties of recombinant olfactory receptors can differ based on the cellular environment, membrane composition, and presence of accessory proteins.

  • Standardize experimental protocols: Variations in calcium imaging protocols, electrophysiological recording techniques, and ligand application methods can contribute to data inconsistencies. Implementing standardized protocols similar to those described for OR17-40 characterization can reduce methodological variability .

  • Dose-response relationships: Conflicting results may arise from testing different concentration ranges. Complete dose-response curves (typically in the lower micromolar range for olfactory receptors) should be generated for suspected ligands .

  • Control experiments: Include appropriate controls such as:

    • Mock-transfected cells to control for endogenous responses

    • Cells transfected with other receptors to control for non-specific effects

    • Positive controls (e.g., ATP application to activate endogenous P2Y receptors in HEK293 cells)

  • Independent validation: Use complementary techniques to verify interactions. For instance, if calcium imaging suggests a potential ligand, confirm with electrophysiological recordings or cAMP assays.

  • Receptor variants analysis: Consider potential polymorphisms in the OR4C13 sequence that might affect ligand binding properties. Sequence verification should precede functional studies.

By systematically addressing these factors, researchers can develop a consensus view of OR4C13 ligand interactions that reconciles apparently conflicting data.

What are the critical considerations for designing mutation studies of OR4C13?

Designing effective mutation studies for OR4C13 requires careful consideration of several key factors:

  • Structure-based targeting: In the absence of crystal structures for OR4C13, comparative modeling based on better-characterized GPCRs should guide the selection of residues for mutation. Focus on:

    • Transmembrane domains predicted to form the ligand-binding pocket

    • Conserved residues among olfactory receptors that may be involved in signal transduction

    • Variable regions that likely contribute to ligand specificity

  • Mutation strategy selection:

    • Alanine scanning mutagenesis to systematically identify functionally important residues

    • Conservative substitutions (e.g., Leu to Ile) to probe subtle structural requirements

    • Radical substitutions to test hypotheses about electrostatic or hydrophobic interactions

    • Chimeric constructs combining regions of OR4C13 with other olfactory receptors to map functional domains

  • Expression verification: Implement methods to confirm that mutant receptors are properly expressed, folded, and trafficked to the cell membrane. This might include:

    • Western blotting to verify protein expression

    • Immunocytochemistry to confirm membrane localization

    • Use of epitope tags (like the c-myc tag used with OR17-40) for detection

  • Functional characterization:

    • Calcium imaging assays to measure changes in intracellular calcium in response to odorants

    • Electrophysiological recordings in systems like Xenopus oocytes to detect changes in conductance

    • Use of "reporter" channels co-expressed with the receptor to amplify signals

  • Data analysis framework:

    • Establish clear criteria for categorizing mutations (e.g., loss of function, altered specificity)

    • Quantitative comparison of dose-response relationships between wild-type and mutant receptors

    • Statistical analysis to determine the significance of observed differences

By incorporating these considerations into the experimental design, mutation studies can provide valuable insights into the structure-function relationships of OR4C13.

What protocols yield optimal expression of recombinant OR4C13 in heterologous systems?

Optimal expression of recombinant OR4C13 in heterologous systems can be achieved by adapting protocols that have proven successful for other human olfactory receptors:

For HEK293 Cell Expression:

  • Vector construction:

    • Clone the OR4C13 coding sequence into a mammalian expression vector with a strong promoter (e.g., CMV)

    • Include a membrane import sequence, such as the 5-HT3 receptor sequence (23 amino acids) used for OR17-40, to enhance membrane targeting

    • Add an epitope tag (e.g., c-myc) for easy detection and confirmation of expression

  • Transfection protocol:

    • For transient expression: Use calcium phosphate precipitation technique with semiconfluent HEK293 cells in 35 mm dishes

    • For stable cell line creation: Transfect HEK293 cells and select with G418 (500 mg/l) as done for OR17-40

    • Include a reporter plasmid (e.g., pCH110 coding for β-galactosidase) to assess transfection efficiency

  • Culture conditions:

    • Maintain cells at 37°C in MEM supplemented with 10% heat-inactivated fetal calf serum

    • Use a humidified 95% air-5% CO2 incubator

    • Perform measurements 48-72 hours after transfection for transient expression

For Xenopus laevis Oocyte Expression:

  • cRNA preparation:

    • Linearize the plasmid containing OR4C13 with an appropriate restriction enzyme

    • Synthesize cRNA using the appropriate RNA polymerase (e.g., T7 or T3) in the presence of capping analog m7G(5')ppp(5')G

  • Oocyte injection:

    • Select mature healthy oocytes (stages V-VI)

    • Inject approximately 50 nl of cRNA (concentration ~1 μg/μl) using a pressure injector

    • Consider co-expression with a "reporter" channel to amplify signals during functional assays

  • Post-injection culture:

    • Place injected oocytes in fresh Barth's solution

    • Incubate at 20°C for 5-7 days before testing for functional expression

Enhancement strategies for both systems:

  • Co-express accessory proteins that may facilitate proper folding and trafficking

  • Optimize the codon usage of the OR4C13 sequence for the expression system

  • Include chaperone proteins to enhance proper protein folding

  • Use chemical chaperones in the culture medium (e.g., DMSO, glycerol)

These protocols provide a comprehensive framework that can be optimized specifically for OR4C13 expression based on empirical results.

What are the most effective methods for measuring OR4C13 activation in response to potential ligands?

Effective measurement of OR4C13 activation requires sensitive and reliable techniques that can detect receptor responses to ligand binding. Based on successful approaches with other olfactory receptors, the following methods are recommended:

Calcium Imaging Assays:

  • Protocol overview:

    • Load OR4C13-expressing cells with calcium-sensitive fluorescent dyes (e.g., Fura-2 AM)

    • Establish baseline fluorescence measurements

    • Apply potential ligands (individually or as mixtures) for short durations (e.g., 2 seconds)

    • Monitor changes in intracellular calcium concentration

  • Data analysis:

    • Measure the amplitude and kinetics of calcium transients

    • Calculate the relative increase in fluorescence ratio over baseline

    • Apply positive controls (e.g., ATP to activate endogenous P2Y receptors in HEK293 cells)

    • Include mock-transfected cells as negative controls

  • Optimization considerations:

    • Allow sufficient washout time (3-5 minutes) between applications to permit signal recovery

    • Test a range of ligand concentrations to generate complete dose-response curves

    • Use appropriate solvents for hydrophobic odorants and include vehicle controls

Electrophysiological Recording (for Xenopus oocyte expression):

  • Two-electrode voltage clamp:

    • Voltage clamp the oocytes to measure their response to odors

    • Use electrodes filled with 3 M KCl

    • Deliver odorants via a multibarrel single-tip superfusion device

  • Conductance measurements:

    • Measure conductance changes as either the slope of the current signal in response to a voltage ramp (e.g., from -50 to +50 mV) or

    • Record the amplitude of current induced by voltage steps (e.g., 2 sec steps from -50 to +50 mV)

  • Response quantification:

    • Calculate the relative conductance of the oocyte in response to simultaneous application of the odor and a phosphodiesterase inhibitor (e.g., IBMX)

    • Normalize to the conductance in response to the phosphodiesterase inhibitor alone

Additional Complementary Approaches:

  • cAMP assays to directly measure changes in second messenger levels following receptor activation

  • BRET/FRET-based assays to monitor protein-protein interactions involved in signal transduction

  • Reporter gene assays that couple receptor activation to expression of luciferase or other easily measurable outputs

The integration of multiple measurement techniques provides robust validation of OR4C13 activation by potential ligands and helps characterize the receptor's response properties.

What troubleshooting approaches can address poor expression or functionality of recombinant OR4C13?

When encountering challenges with expression or functionality of recombinant OR4C13, systematic troubleshooting approaches can help identify and resolve issues:

Expression Level Problems:

  • Vector optimization:

    • Verify the integrity of the OR4C13 sequence through sequencing

    • Try alternative promoters if expression levels are low

    • Include a Kozak consensus sequence before the start codon to enhance translation efficiency

    • Add an N-terminal membrane import sequence, such as the 5-HT3 receptor sequence used successfully with OR17-40

  • Codon optimization:

    • Analyze the codon usage in the OR4C13 sequence

    • Optimize codons for the specific expression system (HEK293 cells or Xenopus oocytes)

    • Remove rare codons that might cause translational pausing

  • Transfection/expression conditions:

    • For HEK293 cells: Optimize cell density, DNA amount, and transfection reagent ratios

    • For Xenopus oocytes: Adjust cRNA concentration and injection volume

    • Extend expression time before functional testing (48-72 hours for HEK293; 5-7 days for oocytes)

Membrane Targeting Issues:

  • Trafficking enhancement:

    • Co-express with receptor transporting proteins (RTPs) or receptor expression enhancing proteins (REEPs)

    • Add trafficking enhancer sequences to the construct

    • Include epitope tags (like c-myc) that can help monitor localization

  • Visualization approaches:

    • Use immunocytochemistry with epitope tag antibodies to verify membrane localization

    • Consider fusion with fluorescent proteins to directly visualize receptor distribution

    • Perform cell surface biotinylation assays to quantify membrane expression

Functional Response Problems:

  • Signal transduction verification:

    • Test coupling to different G-protein subtypes by co-expression experiments

    • Verify the functionality of downstream signaling components in the heterologous system

    • Use positive controls like ATP application to HEK293 cells to confirm the calcium imaging system is working properly

  • Ligand application optimization:

    • Ensure proper solubilization of hydrophobic odorants

    • Test multiple application methods (e.g., bath application vs. local perfusion)

    • Consider potential desensitization issues and adjust application protocols accordingly

    • Allow sufficient recovery time between applications (3-5 minutes)

  • Sensitivity enhancement:

    • Co-express with "reporter" channels in oocyte systems to amplify signals

    • Use more sensitive detection methods for calcium imaging

    • Consider signal amplification approaches like calcium-induced calcium release

Experimental Controls:

  • Include mock-transfected cells as negative controls

  • Use cells expressing well-characterized receptors as positive controls

  • Implement internal controls for transfection efficiency and cell viability

By systematically addressing these potential issues, researchers can optimize both the expression and functional characterization of recombinant OR4C13.

How does the ligand binding profile of OR4C13 compare with other characterized human olfactory receptors?

The ligand binding profile of OR4C13 should be examined within the broader context of human olfactory receptor diversity and specificity patterns. While specific OR4C13 ligand data is limited in the current literature, comparative analysis provides valuable frameworks:

Structure-Function Relationships:

Human olfactory receptors display varying degrees of ligand specificity. Some receptors, like OR17-40, show high selectivity, responding strongly to helional and its close structural analog heliotropylacetone, but not to other structurally related compounds like piperonal, safrole, and vanillin . This suggests that even minor structural differences in ligands can dramatically affect receptor activation.

To characterize OR4C13's specificity profile, researchers should:

  • Systematically test structurally diverse odorants, beginning with broad chemical classes represented in screening mixtures like Henkel 100

  • Develop structure-activity relationships by testing structural analogs of any identified activating compounds

  • Compare binding affinities (EC50 values) across different ligands to establish a selectivity profile

Receptor Classification Considerations:

As a Class II (tetrapod-specific) olfactory receptor , OR4C13 may share ligand preferences with other receptors in this evolutionary group. Comparative analysis with other Class II receptors could reveal shared structural features that determine ligand recognition patterns.

The following table compares characteristics of selected human olfactory receptors:

ReceptorClassKnown LigandsSpecificity ProfileExpression System Used
OR17-40IIHelional, HeliotropylacetoneHighly selectiveHEK293 cells, Xenopus oocytes
OR4C13IITo be determinedTo be determinedPotential systems: HEK293, Xenopus oocytes
OR10Z1-Native detection with ELISA--

Combinatorial Coding:

In the mammalian olfactory system, odor identities are encoded through combinatorial receptor activation patterns, where individual receptors may respond to multiple odorants and individual odorants may activate multiple receptors . Understanding OR4C13's position within this combinatorial coding scheme requires:

  • Identifying its ligand recognition profile

  • Determining which other olfactory receptors respond to the same ligands

  • Assessing whether OR4C13 functions primarily as a broadly tuned or narrowly selective receptor

Through these comparative approaches, researchers can place OR4C13's ligand binding characteristics within the broader context of human olfactory receptor function.

What are the most reliable antibodies and detection methods for OR4C13 research?

Selecting reliable antibodies and detection methods for OR4C13 research requires careful consideration of specificity, sensitivity, and application compatibility:

Antibody Selection Guidelines:

While specific antibody data for OR4C13 is limited in the provided search results, the general principles of antibody validation for olfactory receptors apply:

  • Specificity validation:

    • Test antibodies against cells expressing recombinant OR4C13 versus non-expressing controls

    • Perform peptide competition assays to confirm binding specificity

    • Consider cross-reactivity with other olfactory receptors, especially those with high sequence homology

  • Application optimization:

    • Validate antibodies separately for each application (Western blot, immunocytochemistry, flow cytometry, etc.)

    • Optimize conditions (antibody concentration, incubation time, blocking reagents) for each application

    • Document reproducibility across different lots of the same antibody

The search results indicate that up to 39 antibodies may be available for OR4C13 , though their validation status and specific applications are not detailed.

Alternative Detection Strategies:

When antibody limitations exist, alternative approaches can enhance detection reliability:

  • Epitope tagging:

    • Adding c-myc or other well-characterized epitope tags to recombinant OR4C13 constructs enables detection with highly validated commercial antibodies

    • Position tags carefully to avoid interfering with receptor function or trafficking

    • Consider dual tagging (N- and C-terminal) to verify full-length expression

  • Fusion protein approaches:

    • GFP or other fluorescent protein fusions allow direct visualization

    • Luciferase or nanoluciferase fusions enable sensitive detection in live cells

    • Split reporter systems can monitor protein-protein interactions

  • mRNA detection:

    • qRT-PCR with validated primer sets for OR4C13

    • In situ hybridization to localize expression in native tissues

    • Single-cell RT-PCR to correlate receptor expression with functional responses

Quantification Methods:

For quantitative analysis of OR4C13 levels:

  • Protein quantification:

    • Quantitative Western blotting with appropriate loading controls

    • Flow cytometry for cell surface expression levels

    • ELISA-based approaches similar to those used for other olfactory receptors like OR10Z1

  • Expression level monitoring:

    • Establishment of standard curves using purified recombinant protein

    • Relative quantification against housekeeping proteins

    • Absolute quantification using mass spectrometry-based approaches

By implementing these strategies and rigorously validating detection methods, researchers can establish reliable tools for OR4C13 detection across different experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.