Recombinant Human Olfactory receptor 4C16 (OR4C16)

What is the molecular structure of OR4C16?

OR4C16 is a 310-amino acid transmembrane protein belonging to the olfactory receptor family. Its full sequence begins with MQLNNNVTEFILLGLTQDPFWKKIVFVIFLRLYLGTLLGNLLIIISVKTSQALKNPM and continues through the complete protein structure as documented in protein databases . As a G protein-coupled receptor (GPCR), OR4C16 features the characteristic seven-transmembrane domain structure typical of this receptor family. The protein contains several conserved regions that are crucial for its function, including ligand binding and G-protein interaction domains. When expressed recombinantly, the protein typically includes an N-terminal 10xHis-tag to facilitate purification and detection in experimental settings .

What are the alternative names and identifiers for OR4C16?

The primary recommended name for this protein is Olfactory receptor 4C16, though it's alternatively known as Olfactory receptor OR11-135 . In terms of database identifiers, OR4C16 is tracked across multiple research platforms with the following IDs: UniProt ID Q8NGL9, RefSeq Accession NP_001004701.2, PRO ID PR:Q8NGL9, and Open Targets ID ENSG00000279514 . Additionally, it's indexed in specialized databases such as GlyCosmos Protein (Q8NGL9), STRING Protein ID (9606.ENSP00000485295), and neXtProt Accession (NX_Q8NGL9) . These standardized identifiers ensure consistency in referring to OR4C16 across different research contexts and database systems.

How should recombinant OR4C16 be stored to maintain stability and activity?

Optimal storage conditions for recombinant OR4C16 require temperatures of -20°C, with extended storage recommended at -20°C or -80°C . The protein's stability is significantly affected by repeated freeze-thaw cycles, which should be avoided to preserve functional integrity. For short-term work, working aliquots can be stored at 4°C for up to one week without significant loss of activity . The shelf life of recombinant OR4C16 varies depending on the formulation: liquid preparations typically maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized forms offer extended stability of up to 12 months under the same storage conditions . It's important to note that shelf life is influenced by multiple factors beyond temperature, including buffer composition, additives, and the intrinsic stability properties of the protein itself . When preparing the protein for functional assays, careful attention to these storage recommendations will help ensure consistent experimental results.

What plasmid construction methodology is recommended for OR4C16 expression?

Based on successful methodologies used for other human olfactory receptors, a recommended approach for OR4C16 expression involves constructing a plasmid that incorporates membrane import sequences and epitope tags to enhance expression and detection. The construction process typically begins with PCR amplification of the OR4C16 coding region from human genomic DNA using high-fidelity polymerase such as Pfu . For enhanced membrane localization, incorporation of a membrane import sequence, such as the 23 amino acid sequence from the 5-HT3 receptor, has proven beneficial for other olfactory receptors . Additionally, inclusion of an epitope tag, such as the c-myc tag (MEQKLISEEDLN), facilitates detection of the expressed protein .

The PCR product containing the OR4C16 coding sequence can be digested with appropriate restriction enzymes (e.g., XbaI) and subcloned into a vector containing the membrane import sequence and epitope tag . For mammalian expression, vectors containing strong promoters such as CMV are recommended, while for oocyte expression, vectors compatible with in vitro transcription systems should be selected . Following construction, plasmid sequence and orientation should be verified by sequencing before proceeding to transfection or cRNA synthesis.

How can functional activity of recombinant OR4C16 be measured in heterologous systems?

Functional activity of recombinant OR4C16 can be assessed using several complementary approaches, with calcium imaging and electrophysiology being the most established methods. For calcium imaging in transfected HEK293 cells, researchers can monitor transient increases in intracellular calcium concentration ([Ca2+]) in response to potential ligand stimulation . This approach involves loading cells with calcium-sensitive fluorescent dyes and recording fluorescence changes upon odorant application using microscopy or plate reader systems. The methodology has successfully identified specific ligands for other human olfactory receptors and could be applied to OR4C16 .

For electrophysiological measurements, Xenopus laevis oocytes co-expressing OR4C16 with a "reporter" channel (such as CFTR) provide a robust system . In this approach, oocytes are voltage-clamped using a two-electrode voltage clamp, and their response to potential ligands is measured as changes in conductance, either as the slope of the current signal in response to a voltage ramp (-50 to +50 mV) or as the amplitude of current induced by voltage steps . This system allows for precise quantification of receptor activation and dose-response relationships. Both methodologies can be used to systematically screen odorant libraries to identify specific ligands for OR4C16 and characterize its activation properties.

What strategies can be employed to identify specific ligands for OR4C16?

Identifying specific ligands for OR4C16 requires a systematic deconvolution approach similar to that used for other olfactory receptors. An effective strategy begins with screening a diverse odorant mixture (such as the Henkel 100 used for OR17-40) against cells expressing recombinant OR4C16 . If the mixture elicits a response, it can be progressively subdivided into smaller groups of compounds to isolate the active component(s) . Once candidate ligands are identified, structure-activity relationship studies should be conducted by testing structurally related molecules to determine the specific molecular features required for receptor activation .

For OR4C16 specifically, this approach would involve testing the receptor against diverse odorant panels, focusing particularly on compound classes known to activate other receptors in the OR4C subfamily. The screening should employ multiple concentrations (typically ranging from nanomolar to micromolar) to establish dose-response relationships . Complementary methods such as competitive binding assays can further validate ligand specificity. Importantly, proper controls including mock-transfected cells and cells expressing unrelated receptors must be included to confirm response specificity . This systematic approach has successfully identified specific ligands for other human olfactory receptors (e.g., helional for OR17-40) and represents the most robust methodology for OR4C16 ligand discovery.

How can structure-activity relationships be established for OR4C16 ligands?

Establishing structure-activity relationships (SARs) for OR4C16 ligands requires a methodical approach combining computational modeling with experimental validation. First, once a lead ligand is identified through screening approaches, systematic structural modifications should be introduced to the molecule, creating a focused library of analogs that vary in specific functional groups, stereochemistry, or molecular size . Each analog should then be tested for its ability to activate OR4C16 using the functional assays described previously (calcium imaging or electrophysiology) .

The approach used for OR17-40 provides a valuable template, where researchers identified helional as an activating ligand and then tested structurally related molecules such as heliotroplyacetone, piperonal, safrole, and vanillin . Only heliotroplyacetone, which closely resembled helional, also activated the receptor, while the other compounds were ineffective despite structural similarities . For OR4C16, a similar comparative analysis would identify the essential structural elements required for receptor binding and activation. Additionally, homology modeling of the OR4C16 binding pocket, based on the receptor's amino acid sequence and known GPCR structures, can provide insights into ligand-receptor interactions. Docking simulations with identified ligands can further elucidate the molecular basis of specificity and guide the design of modified ligands with potentially enhanced activity or specificity.

What statistical approaches are recommended for analyzing OR4C16 functional data?

Analysis of OR4C16 functional data requires robust statistical methodologies to account for biological variability and signal-to-noise considerations inherent in receptor activation assays. For calcium imaging data, response amplitudes should be normalized to baseline levels and expressed as percentage increases or as ΔF/F ratios . When comparing responses to different ligands or concentrations, ANOVA with appropriate post-hoc tests (such as Tukey's HSD) is recommended for multiple comparisons, while paired t-tests may be suitable for binary comparisons when the same cells are exposed to different conditions .

How can contradictory results in OR4C16 activation studies be reconciled?

Contradictory results in OR4C16 activation studies may arise from multiple factors including differences in expression systems, receptor constructs, assay conditions, or data analysis methods. A systematic approach to reconciling such contradictions begins with a detailed comparison of methodological differences between studies . Key parameters to evaluate include: (1) the exact sequence of the OR4C16 construct used, particularly with respect to epitope tags or fusion partners that might affect receptor function; (2) the expression system employed (E. coli, HEK293, oocytes, etc.), as different systems may support varying levels of functional expression or post-translational modifications; (3) assay conditions, including buffer composition, temperature, and detection methods; and (4) data analysis approaches, particularly threshold definitions for positive responses .

Follow-up experiments should directly compare the conflicting conditions in parallel using standardized protocols. When possible, orthogonal methods should be employed to validate findings – for instance, if contradictory results emerge from calcium imaging studies, electrophysiological measurements or direct binding assays could provide clarifying evidence . Additionally, positive and negative controls must be rigorously implemented in all comparative studies. If differences persist despite methodological standardization, they may reflect genuine biological complexity, such as receptor polymorphisms or the influence of accessory proteins present in different expression systems. Documenting these contextual differences contributes valuable information about the factors influencing OR4C16 function in different experimental settings.

What are common challenges in OR4C16 expression and how can they be addressed?

Expression of functional OR4C16, like other olfactory receptors, faces several challenges that require specific strategies to overcome. One primary challenge is achieving sufficient membrane localization, as olfactory receptors often show retention in the endoplasmic reticulum when expressed in heterologous systems . This can be addressed by incorporating membrane import sequences, such as the 5-HT3 receptor sequence, as demonstrated effective for other olfactory receptors . Additionally, growth at lower temperatures (30°C instead of 37°C) may improve folding and trafficking to the plasma membrane.

Low expression levels represent another common challenge. This can be mitigated through codon optimization of the OR4C16 sequence for the expression system being used, and by using strong promoters in expression vectors . For stable cell lines, selection of high-expressing clones through fluorescence-activated cell sorting or limited dilution cloning can significantly improve yield. Protein instability issues may be addressed through the use of chemical chaperones or by screening different detergents for solubilization and purification steps if working with isolated protein .

For functional studies, inconsistent responses may arise due to variable receptor expression levels. This can be controlled by quantifying surface expression through antibody labeling of epitope tags or through normalization to control responses. Implementing these strategies systematically can substantially improve the success rate of OR4C16 expression and functional characterization.

What quality control parameters should be monitored for recombinant OR4C16?

Quality control of recombinant OR4C16 requires monitoring multiple parameters to ensure protein integrity and functionality. For protein production, purity should be assessed using SDS-PAGE and Western blotting with antibodies against the His-tag or the receptor itself . Mass spectrometry can confirm the correct molecular weight and sequence integrity. Proper folding can be evaluated through circular dichroism spectroscopy, which provides information about secondary structure elements typical of GPCRs.

For functional studies in cellular systems, surface expression should be verified through immunocytochemistry or flow cytometry using antibodies against epitope tags incorporated into the receptor construct . Receptor functionality should be confirmed using positive control ligands once they are identified for OR4C16, or initially using broad odorant mixtures known to activate multiple receptors . Dose-response relationships should exhibit expected pharmacological characteristics, including saturation at high concentrations.

When working with purified protein, stability should be monitored over time under different storage conditions using methods such as dynamic light scattering or size-exclusion chromatography . For long-term storage, activity assays should be performed periodically to ensure retained functionality. Documentation of passage number for cell lines, oocyte batch variability, and transfection efficiency is also essential for interpreting experimental outcomes and troubleshooting inconsistent results . Implementing these quality control measures systematically ensures reliable and reproducible research outcomes when working with OR4C16.